PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10016671m
Common NameEUTSA_v10016668mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 440aa    MW: 46655.4 Da    PI: 9.3189
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10016671mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.29.6e-15354405556
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                      +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN +Lk  l el+ + 
  Thhalv10016671m 354 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALGELERKR 405
                      79*********************************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-16350414IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.645352404IPR004827Basic-leucine zipper domain
PfamPF001707.8E-14354402IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.0E-15354402No hitNo description
CDDcd147071.49E-24354408No hitNo description
SuperFamilySSF579592.31E-11354402No hitNo description
PROSITE patternPS000360357372IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MVVRETAMMP EREVESSTAQ TRHNGGSGGE NHPFSSLGRQ SSIYSLTLDE FQHALCENGK  60
NFGSMNMDEF LVSIWNAEEN NNNQQAAAAA SNPVPPNHNG FNNSNNNNGG AESNVFGGGG  120
SSGNQGANKR SVIAKEPSLA RQGSLTLPAP LCRKTVDEVW SEIHRGGGGG DRSGRTSSSN  180
GQDNAQNGGE IAARQPTFGE MTLEDFLVKA GVVREHPTNP NPNPNPNPNS NQNQSSVIPA  240
ATQQQLYGVF QGTGDPTFPG QAMSVGDPSG YGKRTGGGGG YQQAPPGVCY GGGGGGFGGG  300
GQQMGMVGPL SPVSSDGLGH GQVDNIGSQY GVDMGGLRGR KRVVDGPVEK VVERRQRRMI  360
KNRESAARSR ARKQAYTVEL EAELNQLKEE NAQLKHALGE LERKRKQQYF ESLKTRAQPK  420
LPKASGRLRT LMRNPSCPL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410797.10.0hypothetical protein EUTSA_v10016668mg
RefseqXP_006410798.10.0hypothetical protein EUTSA_v10016668mg
SwissprotQ9SJN00.0ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLV4NZ570.0V4NZ57_EUTSA; Uncharacterized protein
STRINGAT2G36270.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.10.0bZIP family protein