PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10016349m
Common NameEUTSA_v10016349mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family TALE
Protein Properties Length: 678aa    MW: 73927.8 Da    PI: 6.9309
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10016349mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-094014381954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Thhalv10016349m 401 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 438
                      554459******************************88 PP

2BELL123.48.8e-40260331172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erqe+q+kkakL s+l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  Thhalv10016349m 260 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQI 331
                      79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.0E-77178329IPR006563POX domain
PfamPF075265.1E-47184328IPR006563POX domain
PROSITE profilePS5007112.26379442IPR001356Homeobox domain
SMARTSM003892.3E-9382446IPR001356Homeobox domain
CDDcd000864.18E-12382442No hitNo description
SuperFamilySSF466895.56E-17383449IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-29385449IPR009057Homeodomain-like
PfamPF059202.8E-18399438IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MAAYFHGNPP EISAGSDGGL QTLILMNPTT YVQYTQQDND SNNNINNNSN NNTNNNNSFV  60
FLDSHAPPQN TSQQFVGIPL SGHEAASITA ADNISVLHGY PPRVQYSLYN SHQVDPTHQQ  120
AACETPRAQQ GLSLTLSSQQ QQQQQHHNQN RPLHHVGFGS GPGEDIRVGS GSTGSGVTNG  180
IANLVSSKYL KAAQELLDEV VNADSNDINT TKSQLFSSKK GSSGNDKAVG ESSAGGATGE  240
GSGGGGEASG KRTVELGTAE RQEIQMKKAK LSSMLHEVEQ RYRQYHQQMQ MVISSFEQAA  300
GIGSAKSYTS LALKTISRQF RCLKEAIAGQ IKAANKSLGE EDSVSGVGRF EGSRLKFVDH  360
HLRQQRALQQ LGMIQHPSNN AWRPQRGLPE RAVSVLRAWL FEHFLHPYPK DSDKHMLAKQ  420
TGLTRSQVSN WFINARVRLW KPMVEEMYME EMKEQGKNMG SMEKTPLDQN NEDSASKSTS  480
NQEKSPMGGG ADNYHLNPNH EGDLEGVTGM QGSPKRLRTS EDTMMQPINA DFSSNEKLTM  540
KILEERQGIR SDGGYPFMGN FGQYQMDEMS RFDVAVSDQE LLAQRYSGNN NGVSLTLGLP  600
HCDSLSSTHH QGFMQTHHGI PIGRRVKIGE TEEYGAAALN GGGGSAATAH SSAAVYNGMN  660
IQNQKRYVAQ LLPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16388445158Homeobox protein Meis1
4xrs_B1e-16388445158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10016349m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2272720.0AK227272.1 Arabidopsis thaliana mRNA for putative homeodomain transcription factor, complete cds, clone: RAFL11-09-C20.
GenBankAY0721750.0AY072175.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0965480.0AY096548.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0998540.0AY099854.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankBT0084220.0BT008422.1 Arabidopsis thaliana At2g35940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410765.10.0BEL1-like homeodomain protein 1
RefseqXP_006410766.10.0BEL1-like homeodomain protein 1
RefseqXP_024004303.10.0BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLV4MAR00.0V4MAR0_EUTSA; Uncharacterized protein
STRINGXP_006410764.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]