PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10016317m
Common NameEUTSA_v10016317mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 723aa    MW: 78017.5 Da    PI: 6.3182
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10016317mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.13.8e-13225286162
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  Thhalv10016317m 225 EEDEKKRARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKISYFMAENATLRQQ 286
                      67789999****************************************99999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-16225289IPR004827Basic-leucine zipper domain
PfamPF001703.9E-11226287IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.358227287IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.6E-17229287No hitNo description
SuperFamilySSF579592.81E-12229287No hitNo description
CDDcd147044.85E-22230281No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MAAPITEEPP PAPDPNSTLA PPDFDSIPIP PFDQFYHSGS DQVPIGELMS DLGFPVDADG  60
EFELTFDGMD DLYFPAENET FLIPVNASNQ EQFGDFTPES EGSGISGDSL PKGDADKSTS  120
GCCNRDSPRD SGDRCSGADR TLDLPTPLSS QGSGNCGSDV SEATNESSPK SVNVVVDQKV  180
KVEEAATASI TKRKKEIEED MSDESRSSKY RRSGEDADAS AVTGEEDEKK RARLMRNRES  240
AQLSRQRKKH YVEELEEKVR NMHSTITDLN GKISYFMAEN ATLRQQLGGN GMCPPHHPPP  300
PMGMYPPMAP MPYPWMPCPP YMVKQQGSQV PLIPIPRLKP QNPLGASKAK KSESKKSEAK  360
TKKVASISFL GLLLCLFLFG ALAPIVNVNY GGISGAFYGN YRSNYVTDQI YNQHRDRVLE  420
TSRSGAGTGV YNSNGMHCGR DCDRGPGKNM SATESSVPPG NGSEPLVASL FVPRNDKLVK  480
IDGNLIINSI LASEKAVASR KASESNERKA DLVIPKDYSP ALPLPGVGRI EDMAKHLYRS  540
KTEKQKALSS GSADTLKDQI KTKAANGEMQ QWFREGGAGP MFSSGMCTEV FQFDVSSTSG  600
AIIPASPATN VSAEHSKNAT NTRSRKNRRT LRGLPIPLPG SDFNFTKEHQ RNSSSKEIKP  660
ASSMVVSVLV DPREGGDGDI DGMIGGPKSL SRVFVVVLVD SAKYVTYSCV LPRSGAPHLV  720
TT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411360.10.0hypothetical protein EUTSA_v10016317mg
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLV4MJL00.0V4MJL0_EUTSA; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein