PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10015835m
Common NameEUTSA_v10015835mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 191aa    MW: 21820.1 Da    PI: 6.7253
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10015835mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.95e-1471121555
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +++rr+ +NRe+ArrsR RK+  ++eL   v+ L +eN++L ++l++ ++ 
  Thhalv10015835m  71 RKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQASDS 121
                      689***************************************999998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-1067138IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.51969117IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-1170122No hitNo description
PfamPF001703.8E-1271123IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-1371120No hitNo description
CDDcd147023.17E-1872119No hitNo description
PROSITE patternPS0003607489IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MQPINNSSSL SNMQQQDYFQ LNHYYNNLNP TTGVNLIHYP QIQELNLQSP ASNNSTTSDE  60
ATEEIFIINE RKQRRMVSNR ESARRSRMRK QRHLDELLSQ VAWLRSENHQ LLDKLNQASD  120
SNDLVLRENL ILKEENLELR QVITSMKKLR GAGGGSTNIH GRSCSSSLDH DLDQDLISSI  180
SDDPRTHHPS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18390RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00512DAPTransfer from AT5G15830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527210.0AK352721.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-J15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400109.11e-137hypothetical protein EUTSA_v10015835mg
SwissprotQ9FMC26e-33BZP43_ARATH; Basic leucine zipper 43
TrEMBLE4MW241e-137E4MW24_EUTHA; mRNA, clone: RTFL01-03-J15
TrEMBLV4LGP31e-137V4LGP3_EUTSA; Uncharacterized protein
STRINGBra023540.1-P1e-101(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM106321532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15830.14e-63basic leucine-zipper 3