PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10014931m
Common NameEUTSA_v10014931mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 150aa    MW: 17535.2 Da    PI: 9.6978
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10014931mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-1052102555
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      kr +r  +NR+AA++sR +K++++e L +k+keL  + + L+ ++ + +++
  Thhalv10014931m  52 KRLKRILSNRVAAQKSRWKKLQYVEDLVKKSKELHRQVSVLRCQVGMASEQ 102
                      99*********************************9999998777666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.9E-1145108No hitNo description
SMARTSM003382.0E-1048112IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.04850113IPR004827Basic-leucine zipper domain
PfamPF077165.9E-105098IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.48E-1052107No hitNo description
CDDcd147032.16E-1153104No hitNo description
PROSITE patternPS0003605570IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSEPRFPVPR SFQVSNSGSQ EEEKKAGYVN YEVEPGFTIR LRQNIDPAMD PKRLKRILSN  60
RVAAQKSRWK KLQYVEDLVK KSKELHRQVS VLRCQVGMAS EQKRCLEDEQ MELKECISAW  120
FQHFISNEGE IEAYRAEIER LKKKMANMI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399196.11e-107hypothetical protein EUTSA_v10014931mg
TrEMBLV4LAH91e-107V4LAH9_EUTSA; Uncharacterized protein
STRINGBra009288.1-P3e-81(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144181821
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.17e-66bZIP family protein