PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10014851m
Common NameEUTSA_v10014851mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 170aa    MW: 19205.4 Da    PI: 10.3043
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10014851mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.72.2e-1786145160
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                      eke kr +r+ +NR++A+  R+RKka++ eLe++vk Le++N++L ++l++l++e + l+
  Thhalv10014851m  86 EKETKRLKRLLRNRVSAQQARERKKAYLSELENRVKDLENKNSELEERLSTLQNENQMLR 145
                      899****************************************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000419.1E-785101IPR001630cAMP response element binding (CREB) protein
SMARTSM003383.3E-1386150IPR004827Basic-leucine zipper domain
PfamPF001701.0E-1486145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.58788145IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-1490146No hitNo description
Gene3DG3DSA:1.20.5.1703.4E-1790142No hitNo description
CDDcd147044.46E-1691142No hitNo description
PROSITE patternPS00036093108IPR004827Basic-leucine zipper domain
PRINTSPR000419.1E-7103123IPR001630cAMP response element binding (CREB) protein
PRINTSPR000419.1E-7123140IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0010224Biological Processresponse to UV-B
GO:0031539Biological Processpositive regulation of anthocyanin metabolic process
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MQEQATSSLA ASSLPSSSER SSSSAPHLDI KEGIESDEEI RRVPEFGGEA AGKETSGRES  60
GSATGLERTQ TTVGESQRKR GRSPAEKETK RLKRLLRNRV SAQQARERKK AYLSELENRV  120
KDLENKNSEL EERLSTLQNE NQMLRHVRFH LMSMIEHFRL RYHIAVKIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_B9e-18111147339Transcription factor HY5
2oqq_A9e-18111147339Transcription factor HY5
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00117ampDAPTransfer from AT5G11260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0255191e-180BT025519.1 Arabidopsis thaliana At5g11260 mRNA, complete cds.
GenBankAB0054561e-180AB005456.1 Arabidopsis thaliana mRNA for HY5, complete cds.
GenBankAB0052951e-180AB005295.1 Arabidopsis thaliana mRNA for HY5, complete cds.
GenBankAK2293621e-180AK229362.1 Arabidopsis thaliana mRNA for bZip transcription factor HY5 / AtbZip56, complete cds, clone: RAFL16-60-N08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399628.11e-118hypothetical protein EUTSA_v10014851mg
SwissprotO246464e-82HY5_ARATH; Transcription factor HY5
TrEMBLV4N6A21e-118V4N6A2_EUTSA; Uncharacterized protein
STRINGscaffold_601144.17e-80(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56912749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.12e-79bZIP family protein