PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10014081m
Common NameEUTSA_v10014081mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 331aa    MW: 37639.6 Da    PI: 8.7628
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10014081mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.88.4e-57171421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL+kkv + ++++ ++i evd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++
  Thhalv10014081m  17 LPPGFRFHPTDEELITHYLHKKVLDIDFSA-KAIGEVDLNKAEPWELPYKAKMGEKEWYFFCVRDRKYPTGLRTNRATQAGYWKATGKDKEIFR 109
                      79**************************99.88***************99999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++lvg+kktLvfy+grapkg+kt+Wvmheyrl
  Thhalv10014081m 110 -GKSLVGMKKTLVFYRGRAPKGQKTNWVMHEYRL 142
                      .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-6513167IPR003441NAC domain
PROSITE profilePS5100560.16117167IPR003441NAC domain
PfamPF023656.7E-3018142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
METFGGFHKE DDEQMDLPPG FRFHPTDEEL ITHYLHKKVL DIDFSAKAIG EVDLNKAEPW  60
ELPYKAKMGE KEWYFFCVRD RKYPTGLRTN RATQAGYWKA TGKDKEIFRG KSLVGMKKTL  120
VFYRGRAPKG QKTNWVMHEY RLDGKLSAHN LPKTAKNEWV ICRVFHKTAG GKKIPISTLI  180
RIGSYGTGLP PLTDSSPYND KTKTEPIYVP CFSNQTETRG TILNCYSNPA LSSIQPDFLQ  240
RIPLYQPQSL YVSENLQNSN PILAQEQSVS QAMIENSRRQ SFKTLSISQE TGVSNTDISS  300
DFEFGRKGFD HQEVPSSSAG PVDLEPFWNY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D4e-571417317174NAC domain-containing protein 19
3swp_C4e-571417317174NAC domain-containing protein 19
3swp_B4e-571417317174NAC domain-containing protein 19
3swp_A4e-571417317174NAC domain-containing protein 19
3swm_D4e-571417317174NAC domain-containing protein 19
3swm_C4e-571417317174NAC domain-containing protein 19
3swm_B4e-571417317174NAC domain-containing protein 19
3swm_A4e-571417317174NAC domain-containing protein 19
4dul_B4e-571417314171NAC domain-containing protein 19
4dul_A4e-571417314171NAC domain-containing protein 19
1ut7_B4e-571417314171NO APICAL MERISTEM PROTEIN
1ut7_A4e-571417314171NO APICAL MERISTEM PROTEIN
1ut4_B4e-571417314171NO APICAL MERISTEM PROTEIN
1ut4_A4e-571417314171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00496DAPTransfer from AT5G07680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0064190.0BT006419.1 Arabidopsis thaliana At5g07680 gene, complete cds.
GenBankAK2280270.0AK228027.1 Arabidopsis thaliana mRNA for no apical meristem (NAM) -like protein, complete cds, clone: RAFL14-54-D06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399249.10.0hypothetical protein EUTSA_v10014081mg
SwissprotQ9FLR30.0NAC79_ARATH; NAC domain-containing protein 79
TrEMBLV4LE630.0V4LE63_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.6__736__AT5G07680.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.10.0NAC domain containing protein 80