PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10013890m
Common NameEUTSA_v10013890mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 366aa    MW: 41743.2 Da    PI: 8.1371
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10013890mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.26.4e-1279115339
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                      ++k++rr+++NReAAr+sR+RKka++++Le+   +L 
  Thhalv10013890m  79 PDKVQRRLAQNREAARKSRLRKKAYVQQLETSRLKLI 115
                      68****************************8655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-677140IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.81879121IPR004827Basic-leucine zipper domain
PfamPF001706.9E-979110IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.44E-781116No hitNo description
CDDcd147081.48E-2181132No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-783109No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
PfamPF141443.2E-30167242IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MNTTSTHFVT PRRFEIYEPL NQIGMWEESF KNNGGMYTPN SIIIPTNEKP DSLSEDTSHG  60
TEGTTPHKFD QEASTSRHPD KVQRRLAQNR EAARKSRLRK KAYVQQLETS RLKLIQLEQE  120
LDRARQQGFY VGNGVDTNAL GFSDNISSGI VAFEMEYGHW VEEQNRQISE LRTVLHGQVS  180
DVELRSLVET AMKHYVQLFR MKSAAAKIDV FYIMSGMWKT SAERFFLWIG GFRPSELLKV  240
LLPHFDPLTD QQVLNVCNLR KSCQQAEDAV SQGMEKLQHT LTESVAAGKL GEGSYIPQIT  300
CAMERLEALV SFVNHADHLR HETLQQMHRI LTTRQAARGL LALGEYFQRL RALSSSWATR  360
QREPT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530850.0AK353085.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-10-F22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399493.10.0hypothetical protein EUTSA_v10013890mg
SwissprotQ391620.0TGA4_ARATH; Transcription factor TGA4
TrEMBLE4MX380.0E4MX38_EUTHA; mRNA, clone: RTFL01-10-F22
TrEMBLV4N5Z60.0V4N5Z6_EUTSA; Uncharacterized protein
STRINGAT5G10030.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.20.0TGACG motif-binding factor 4