PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10013778m
Common NameEUTSA_v10013785mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 388aa    MW: 43226.3 Da    PI: 4.5861
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10013778mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.54.6e-4861341129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      l+pGfrFhPtd elv +yLk+kv gkkl + ++i+e+diyk+eP+dLp k  +++++ +w+fF++r+kkyatg r+nrat+ gyWk+tgk+++v
  Thhalv10013778m   6 LAPGFRFHPTDVELVRYYLKRKVMGKKLLV-DAIAELDIYKFEPSDLPdKsYIRSGDLKWHFFCPREKKYATGVRANRATECGYWKTTGKERPV 98 
                      579************************999.89**************96346777888************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      l+ + e+vg  ktLv++ g++p+ge+tdWvmheyrle
  Thhalv10013778m  99 LC-NAEVVGKIKTLVYHFGKSPRGERTDWVMHEYRLE 134
                      **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-563156IPR003441NAC domain
PROSITE profilePS5100552.4376156IPR003441NAC domain
PfamPF023655.2E-268133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGKTQLAPGF RFHPTDVELV RYYLKRKVMG KKLLVDAIAE LDIYKFEPSD LPDKSYIRSG  60
DLKWHFFCPR EKKYATGVRA NRATECGYWK TTGKERPVLC NAEVVGKIKT LVYHFGKSPR  120
GERTDWVMHE YRLEDKVLTQ KNVPQDTYVL CVLFKKDGPG PRNGAQYGAP FKEEDWSDEE  180
QHTDVPAINN PANLDVPNNE TCLVVGSSHD ANKDCFGGMI SESCVSDFLP ATTTTTTCEV  240
PHPNDAANTP MSAAPLFDFN STASLEQTLQ APNNDDDIYS MLDLFVDEDE YLRFSEPNNN  300
EVRHDPGVSA PVCVEVGEGI FSELPDLSNM HYNGVPSTPS YDLVENSEFY IELQDLIAPL  360
STPQIGNASD SNSPGSNPWR VGRPPLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-44615615168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399407.10.0hypothetical protein EUTSA_v10013785mg
RefseqXP_006399408.10.0hypothetical protein EUTSA_v10013785mg
RefseqXP_006399409.10.0hypothetical protein EUTSA_v10013785mg
SwissprotQ9FY820.0NAC82_ARATH; NAC domain-containing protein 82
TrEMBLV4LEM00.0V4LEM0_EUTSA; Uncharacterized protein
STRINGBra028640.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36922562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.40.0NAC domain containing protein 82