PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10012728m
Common NameEUTSA_v10012728mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARF
Protein Properties Length: 792aa    MW: 87749.7 Da    PI: 5.8655
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10012728mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.72.7e-24174275199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   +++
  Thhalv10012728m 174 FCKTLTASDTSTHGGFSVPRRAAEDCfapldyK-QQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RDE 264
                      99****************************963.3445679************************************************..569 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+++++r+
  Thhalv10012728m 265 DGELRLGIRRS 275
                      9999****996 PP

2Auxin_resp124.47.7e-41299380182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +a+a+stks+F+v+Y+Pra+++eFv+++ek+ +++++++++G+Rf+m+fe+eds+err++G+v+gv dldp+rWpnSkWr+L
  Thhalv10012728m 299 VANAVSTKSMFHVFYSPRATHAEFVIPYEKYTTSIRNPICIGTRFRMRFEMEDSPERRCAGVVTGVCDLDPYRWPNSKWRCL 380
                      689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.5E-40165288IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-42168280IPR015300DNA-binding pseudobarrel domain
CDDcd100173.21E-21172274No hitNo description
PROSITE profilePS5086313.437174276IPR003340B3 DNA binding domain
SMARTSM010193.4E-23174276IPR003340B3 DNA binding domain
PfamPF023622.9E-22174275IPR003340B3 DNA binding domain
PfamPF065072.2E-34299380IPR010525Auxin response factor
SuperFamilySSF542775.4E-10666743No hitNo description
PROSITE profilePS5174521.899668750IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MEFDLNTEIA EVEDEEKDDG GVVGTGIEKG RLGISPSSSS SCSSGSSSSS STTVSASSIY  60
SELWHACAGP LTSLPKKGNV VVYFPQGHLE QDPLVSYSSP LEIPKFDLHP QIFCRVVNVQ  120
LLANKETDEV YTQVTLLPLQ EFSMLNVEGK EVRELGGEEE RNGSSSVKRT PHMFCKTLTA  180
SDTSTHGGFS VPRRAAEDCF APLDYKQQRP SQELIAKDLH GVEWKFRHIY RGQPRRHLLT  240
TGWSIFVSQK NLVSGDAVLF LRDEDGELRL GIRRSARPRN GLPDSIIEKN SCSDILSLVA  300
NAVSTKSMFH VFYSPRATHA EFVIPYEKYT TSIRNPICIG TRFRMRFEME DSPERRCAGV  360
VTGVCDLDPY RWPNSKWRCL LVRWDESFVS DHQERVSPWE IDPSGSLPHL SIQSSPRLKR  420
PWAGLLDTTP PGNPITERGG FLDFEESVRP SKVLQGQENI GSASPLQGFD VMNRRILDFA  480
MQSHANPVLL SSRVKDRFGE FVDATSLDPA CSGVMDLDRF PRVLQGQEIC SLRSFPQIAG  540
FSPAATSGKP SLGYTDPFAY NQANKSSFYP LASQGIRSSH IPYQNPYNAG EKSSVHPINF  600
GGESRKLDAQ NEGGLPKNVT ADLPFKIDMM GKQKGGDFDM NASSECKLFG FSLPVETPAA  660
NPQSSSKRIC TKVHKQGSLV GRAIDLSRLN GYNDLLTELE RLFNMEGLLR DPEKGWRILY  720
TDSENDMMVV GDDPWHDFCN VVLKIHLYTK EEVENGNDDN KSCLEQAAVL MEASKSSSVS  780
QPDSSPTVAR V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-113424062357Auxin response factor 1
4ldw_A1e-113424062357Auxin response factor 1
4ldw_B1e-113424062357Auxin response factor 1
4ldy_A1e-113424062357Auxin response factor 1
4ldy_B1e-113424062357Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10012728m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808320.0AY080832.1 Arabidopsis thaliana auxin response factor ARF4 (At5g60450) mRNA, complete cds.
GenBankAY1139770.0AY113977.1 Arabidopsis thaliana auxin response factor ARF4 (At5g60450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400848.10.0auxin response factor 4 isoform X2
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLV4N9650.0V4N965_EUTSA; Auxin response factor
STRINGXP_006400848.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]