PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10012271m
Common NameEUTSA_v10012271mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 387aa    MW: 41988.8 Da    PI: 8.7678
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10012271mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.47.3e-14307358556
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                      +r++r++kNRe+A rsR+RK+a++ eLe ++++L++ N++L+ +  e+ k+ 
  Thhalv10012271m 307 RRQKRMIKNRESAARSRARKQAYTLELEAEIENLKQVNQDLQIKQAEIMKTH 358
                      79***************************************97777766654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-12303368IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.094305356IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.1E-13307356No hitNo description
CDDcd147072.63E-22307357No hitNo description
PfamPF001702.6E-12307360IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-10307356No hitNo description
PROSITE patternPS000360310325IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGTQINFNNL NEDSSGGNGS NNNQSKPLAR QSSLYALTID ELQSTLGEPG KDFGSMNMDE  60
LLKNIWTAEE TQAIMTTPSS IAAVQPSTGF VPGGNLLQRQ GSLTLPRTLS QKTVDEVWKN  120
LMSKESGNGD MGNSCGSDAP GRQQTLGAIT LEDFLLRAGV VKEDNNSTQM DEDSSGFYHN  180
NGASAGLEFG FGQPNQNNIS FTGNNSLGLK VQQPHQRLPP TIFPKQANVT FAAPLNMVKK  240
SVYEADDGRV NNNSGYASMG GTGVTVAATS PGTSSAENNA WSSPVPVPYV FTRGRRSNTG  300
LEKVVERRQK RMIKNRESAA RSRARKQAYT LELEAEIENL KQVNQDLQIK QAEIMKTHKN  360
ELKESPKQLP CVAKTQCLRR TLTGPW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00087SELEXTransfer from AT1G49720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9719710.0JQ971971.1 Eutrema salsugineum abscisic acid responsive elements-binding factor 1 (ABF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006393221.10.0hypothetical protein EUTSA_v10012271mg
SwissprotQ9M7Q50.0AI5L4_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 4
TrEMBLV4KKT20.0V4KKT2_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__4055__AT1G49720.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.10.0abscisic acid responsive element-binding factor 1