PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10012074m
Common NameEUTSA_v10012074mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARF
Protein Properties Length: 569aa    MW: 63793.4 Da    PI: 7.6825
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10012074mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.93.5e-2210106199
                      EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                      f+k+lt sd+++++ +++p++ ae++              l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   ++++
  Thhalv10012074m  10 FCKTLTASDTSTHRGFSVPRRAAEDCfapllY-----LDHLIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RDED 96 
                      99************************765442.....346999*********************************************..5699 PP

                      E..EEEEE-S CS
               B3  90 felvvkvfrk 99 
                      +el+++++r+
  Thhalv10012074m  97 GELRLGIRRS 106
                      999****996 PP

2Auxin_resp50.96.7e-181471854482
       Auxin_resp  44 RfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      Rf+m+fe+eds+err++G+v+gv dl+p+rWpn kWr+L
  Thhalv10012074m 147 RFRMRFEMEDSPERRCAGVVTGVCDLEPYRWPNTKWRCL 185
                      9*************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.9E-332119IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-335112IPR015300DNA-binding pseudobarrel domain
CDDcd100175.41E-198105No hitNo description
PfamPF023623.7E-2010106IPR003340B3 DNA binding domain
PROSITE profilePS5086312.78810107IPR003340B3 DNA binding domain
SMARTSM010191.6E-2110107IPR003340B3 DNA binding domain
PfamPF065073.9E-13147185IPR010525Auxin response factor
SuperFamilySSF542774.91E-9447524No hitNo description
PROSITE profilePS5174520.062449531IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
SSVKRTPHMF CKTLTASDTS THRGFSVPRR AAEDCFAPLL YLDHLIAKDL HGVEWKFRHI  60
YRGQPRRHLL TTGWSIFVSQ KNLVSGDAVL FLRDEDGELR LGIRRSARPR NGLPDSIIEK  120
NSCSNILSLV ANAVSTKSMF HVFYSPRFRM RFEMEDSPER RCAGVVTGVC DLEPYRWPNT  180
KWRCLLVRWD ESFVSDHQER VSPWEIDPSG SLPQLSIQSS PRPKRPWAGL LDTTPPGNPI  240
TERGGFLDFE ESVRPSKVLQ GQENIGSASP LQGFDVMNRR ILDFAMQSHA NPILLSSRVK  300
DRFGEFVDAT SLDPACSGVM NLDRFPRVLQ GQEICSLRSF PQIAGFSPAA TSGKPNLGYT  360
DPFAYNQANK SKKSSVYPIN FGGETRKFLA QKEGGLPKNV TADFPFKIDM MGKQKGGDFD  420
MNASSECKLF GFSLPVETPA ANPQSSSKRI CTKVHKQESL VGIAIDLSRL NGYNDLLTEL  480
ERLFNMEGLL RDPEKGWRIL YTDSENDMMV VADDPWHDFC NVVLKIHLYT KEEVENGNND  540
NKSCLEQVAV LMEASVSQPD SSPTVTRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A8e-674214118360Auxin response factor 1
4ldw_A8e-674214118360Auxin response factor 1
4ldw_B8e-674214118360Auxin response factor 1
4ldx_A1e-664214118360Auxin response factor 1
4ldx_B1e-664214118360Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10012074m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0134660.0AF013466.1 Arabidopsis thaliana auxin response factor 4 (ARF4) mRNA, complete cds.
GenBankAF3443130.0AF344313.1 Arabidopsis thaliana auxin response factor 4 (At5g60450) mRNA, complete cds.
GenBankAY0808320.0AY080832.1 Arabidopsis thaliana auxin response factor ARF4 (At5g60450) mRNA, complete cds.
GenBankAY1139770.0AY113977.1 Arabidopsis thaliana auxin response factor ARF4 (At5g60450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024006316.10.0LOW QUALITY PROTEIN: auxin response factor 4
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLV4KI310.0V4KI31_EUTSA; Auxin response factor (Fragment)
STRINGXP_006393583.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]