PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10011728m
Common NameEUTSA_v10011728mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 256aa    MW: 29572.2 Da    PI: 10.0901
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10011728mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.43.7e-42134209277
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      Cqv++C+adl+eak+yhrrhkvCevh+ka++v+++g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++
  Thhalv10011728m 134 CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLAGISQRFCQQCSRFHELLEFDEAKRSCRRRLAGHNERRRKSS 209
                      **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.3E-33129195IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.12131208IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-38133212IPR004333Transcription factor, SBP-box
PfamPF031108.8E-32134207IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MHLFHQRSIQ EHSGPYPDFS SPFKHFKRLQ FLQQYHQVPF LNIAKPTRGS FLQESYAQDY  60
NLKAFPLSKM EGRRTQGQGY LKNKASVSYL VEEEMENDMD ENEEGGREEE KRKGVMDRVR  120
GSSGISDRGT SRLCQVDRCT ADLKEAKQYH RRHKVCEVHA KASSVFLAGI SQRFCQQCSR  180
FHELLEFDEA KRSCRRRLAG HNERRRKSSG ESFGEGSGGR RGITGQMIQN QERSRVEIMT  240
TLPMSNSSFK RPQIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-45121207484squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534390.0AK353439.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-30-M04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006392823.10.0hypothetical protein EUTSA_v10011728mg
SwissprotQ9S7581e-86SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLV4KG130.0V4KG13_EUTSA; Uncharacterized protein
STRINGBra039656.1-P9e-97(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-68squamosa promoter binding protein-like 4