PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10011506m
Common NameEUTSA_v10011493mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 427aa    MW: 46840.5 Da    PI: 10.2548
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10011506mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.24.1e-14349399555
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +r+rr++kNRe+A rsR+RK+a++ eLe ++++L++eN++L+ +  ++ ++
  Thhalv10011506m 349 RRQRRMIKNRESAARSRARKQAYTVELEAEIAKLKEENDELQRKQAKIIEM 399
                      79*************************************998766555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-11345411IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.024347396IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-13349396No hitNo description
CDDcd147071.00E-24349403No hitNo description
PfamPF001702.1E-11349401IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-10349396No hitNo description
PROSITE patternPS000360352367IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MVRRQRDTWL RRQKNELETF LGNGLSQKTK ILQNIIFKNN SMGNEPPGDG GGGGALTRPA  60
LTRQGSIYSL TFDEFQSSLG KDFGSMNMDE LLKNIWSAEE TQAMAMAAST SSMIPVPGGQ  120
EGLQLQRQGS LTLPRTLSTK TVDQVWKDLS KDWNSVGGTS LSQSQSQNQS QSQSQSQSQR  180
QQTLGEVTLE EFLVRAGVVR EEAQVAAKDK DGYFGNDANA GFSVQASPRV VPGLMENLGV  240
ETANHLQVQG SSLPLNVNGA RSTYQQQPIL PKQPGFGYGT QIAQLNSPVV RGGLMGLGDQ  300
PLTNNMGFVQ DGIGKNNGDS SSLSPSPYMF NGGVRGRKSG GTVEKVVERR QRRMIKNRES  360
AARSRARKQA YTVELEAEIA KLKEENDELQ RKQAKIIEMQ KNQEMEMRNL EGGPKKRLRR  420
TESGPW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9719720.0JQ971972.1 Eutrema salsugineum abscisic acid responsive elements-binding factor 2 (ABF2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006393640.10.0hypothetical protein EUTSA_v10011493mg
SwissprotQ9M7Q40.0AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLV4MHW90.0V4MHW9_EUTSA; Uncharacterized protein
STRINGBra040260.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-159abscisic acid responsive elements-binding factor 2