PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10011007m
Common NameEUTSA_v10011007mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family LBD
Protein Properties Length: 347aa    MW: 38948.4 Da    PI: 5.5183
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10011007mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.13e-38381381101
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e ++++am+s+++++ +r r+Pv+G++g+ ++lq  +  +++el
  Thhalv10011007m  38 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVKGIVKILENLDEAQKPEAMKSIIFQSYVRDRNPVHGCLGITQHLQYMIWLAEEEL 131
                      7********************************************************************************************* PP

           DUF260  95 allkeel 101
                      ++++++l
  Thhalv10011007m 132 KAVNSQL 138
                      *999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.04937138IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-3538135IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MSQIKTIHNP IGSLKRFLDL LWITFILFMT LKGGTNGACA ACKYQRRRCA ADCPLAPYFP  60
AEQPKLFQNV HRLFGVKGIV KILENLDEAQ KPEAMKSIIF QSYVRDRNPV HGCLGITQHL  120
QYMIWLAEEE LKAVNSQLHL YRNQQNNNNN GQNHHHNQMI HEIGEKQEDI TSQLDLGMGL  180
PINNNPSTSF FSPLNVSETQ QHPYTYEANN NNNGYSPSAT YTNSKEILTN TSLAWGQNGF  240
PYHNSGFINQ NESCNEIKSN NGVMAIQSQL VNLQMVSNQQ EGEGDDVHEY DEIHQFLDII  300
DDRQSFADSK EAYASSSGES LKEPIGEIGE NELRSAATCF SLTSVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-24341417114LOB family transfactor Ramosa2.1
5ly0_B7e-24341417114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10011007m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404319.10.0LOB domain-containing protein 27
SwissprotQ9STS61e-127LBD27_ARATH; LOB domain-containing protein 27
TrEMBLV4LTE60.0V4LTE6_EUTSA; Uncharacterized protein
STRINGXP_006404319.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-129LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]