PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10010997m
Common NameEUTSA_v10010997mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 155aa    MW: 18152.7 Da    PI: 9.1695
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10010997mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1331.3e-1072132363
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      +++r +rk +NRe+A+rsR +K++ +ee      +L+ eN++L ++l     ++++ k+e+
  Thhalv10010997m  72 DDRRKKRKLSNRESAKRSRVKKQKHLEEMSIQLNQLKIENRELTNQLRYVLYHCERAKTEN 132
                      789*****************************************99998888888888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.6E-1066126No hitNo description
SMARTSM003381.1E-1170134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.38172135IPR004827Basic-leucine zipper domain
PfamPF001709.2E-873132IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.44E-974122No hitNo description
CDDcd147023.41E-1775119No hitNo description
PROSITE patternPS0003607792IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MMSTISPVFS SEPCLINPAP AFETGFTPWD ISHLFSVFDT PIDLVPDNES PVSDNNYLNR  60
ASSDIAPTDK TDDRRKKRKL SNRESAKRSR VKKQKHLEEM SIQLNQLKIE NRELTNQLRY  120
VLYHCERAKT ENDRLRLENR ILHDKLLNIR QVLIF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17279DRRKKRKL
27394RRKKRKLSNRESAKRSRVKKQK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026865e-77CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankBT0248235e-77BT024823.1 Arabidopsis thaliana At3g49760 gene, complete cds.
GenBankAY0853075e-77AY085307.1 Arabidopsis thaliana clone 14432 mRNA, complete sequence.
GenBankAL1329655e-77AL132965.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T16K5.
GenBankAK2269235e-77AK226923.1 Arabidopsis thaliana mRNA for bZIP transcription factor AtbZip5, complete cds, clone: RAFL09-21-L10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404104.11e-111hypothetical protein EUTSA_v10010997mg, partial
TrEMBLV4LSW31e-111V4LSW3_EUTSA; Uncharacterized protein (Fragment)
STRINGAT3G49760.14e-76(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.11e-70basic leucine-zipper 5