PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10010675m
Common NameEUTSA_v10010675mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 240aa    MW: 26968.8 Da    PI: 5.3368
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10010675mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.16.4e-1824881128
              NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      gyWkatgk+++v+s ++  +g+k+tLvf+ grapkge+t+W+mhey +
  Thhalv10010675m   2 GYWKATGKERNVKS-GSDIIGTKRTLVFHIGRAPKGERTEWIMHEYCM 48 
                      9*************.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100525.466164IPR003441NAC domain
SuperFamilySSF1019417.06E-20263IPR003441NAC domain
PfamPF023654.9E-8247IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGYWKATGKE RNVKSGSDII GTKRTLVFHI GRAPKGERTE WIMHEYCMIG LSLDALVICR  60
LRKNTEHRGA TIQSLPHPNL STDKHANLQN ETISGWENMV DFYLSNESGH ELLSEIAESS  120
QSSQNPQVPS EEDFYADILR DDIVKLDDPT VSGNTLIDVP RLQTESTSTR VMPLPSMVDK  180
QMQSLLQKLP LQNDIGEENN ISMSSCFIGI YSIKSINRAR WDVVAWVLVM IAVLVFYLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-1426499168NAC domain-containing protein 19
3swp_C3e-1426499168NAC domain-containing protein 19
3swp_B3e-1426499168NAC domain-containing protein 19
3swp_A3e-1426499168NAC domain-containing protein 19
3swm_D3e-1426499168NAC domain-containing protein 19
3swm_C3e-1426499168NAC domain-containing protein 19
3swm_B3e-1426499168NAC domain-containing protein 19
3swm_A3e-1426499168NAC domain-containing protein 19
4dul_B3e-1426496165NAC domain-containing protein 19
4dul_A3e-1426496165NAC domain-containing protein 19
1ut7_B3e-1426496165NO APICAL MERISTEM PROTEIN
1ut7_A3e-1426496165NO APICAL MERISTEM PROTEIN
1ut4_B3e-1426496165NO APICAL MERISTEM PROTEIN
1ut4_A3e-1426496165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529510.0AK352951.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-19-C18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404474.11e-180hypothetical protein EUTSA_v10010675mg
SwissprotQ9LXL91e-154NAC60_ARATH; NAC domain-containing protein 60
TrEMBLE4MWQ41e-178E4MWQ4_EUTHA; mRNA, clone: RTFL01-19-C18
TrEMBLV4LTT71e-180V4LTT7_EUTSA; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_50009021e-152(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43092356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.11e-142NAC domain containing protein 60