PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10010503m
Common NameEUTSA_v10010503mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 351aa    MW: 39323.9 Da    PI: 7.495
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10010503mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM127.88.2e-4061362128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      ++GfrF Pt+ el+++yL+ ++ g ++++++ i+ +d+++veP +Lp+    +++ + ++w fF++r++++a+g r++r+t sgyWkatg+  +
  Thhalv10010503m   6 AVGFRFYPTEVELISFYLRTQLGGGNVTIHSLIPIFDVFSVEPTQLPNlageRCRRDAEQWLFFVPRQEREARGGRPSRTTGSGYWKATGSPGP 99 
                      78***************************999***************656666666888*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      v+s +++++g+kkt+vfy g+ap+g+kt+W m+ey++
  Thhalv10010503m 100 VFSPDNRVIGVKKTMVFYIGKAPTGRKTKWKMNEYKA 136
                      ***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-443163IPR003441NAC domain
PROSITE profilePS5100545.4335163IPR003441NAC domain
PfamPF023651.6E-197135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MEEELAVGFR FYPTEVELIS FYLRTQLGGG NVTIHSLIPI FDVFSVEPTQ LPNLAGERCR  60
RDAEQWLFFV PRQEREARGG RPSRTTGSGY WKATGSPGPV FSPDNRVIGV KKTMVFYIGK  120
APTGRKTKWK MNEYKAVDET SSSYVSTIPK LRHEFSVCRI YVKSGSSRAF DRRPTETFGI  180
ERTLPRYGTE TLSRARISTS PETSYLGRDQ VDMSMNATTQ RNLKVVDELS QLREKKLHSN  240
GVETSSYATI STSPETSYLG RYQVDLSVNG ITTQRNLEMI DELSQHREEK LPSNGAGASS  300
FATISTSPET SYSGGDQVDF SVNATTTQCN SVMVDGLSQP FWEWEQLNWS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-32516817170NAC domain-containing protein 19
4dul_A2e-32516817170NAC domain-containing protein 19
1ut7_B2e-32516817170NO APICAL MERISTEM PROTEIN
1ut7_A2e-32516817170NO APICAL MERISTEM PROTEIN
1ut4_B2e-32516817170NO APICAL MERISTEM PROTEIN
1ut4_A2e-32516817170NO APICAL MERISTEM PROTEIN
3swp_D2e-32516820173NAC domain-containing protein 19
3swp_C2e-32516820173NAC domain-containing protein 19
3swp_B2e-32516820173NAC domain-containing protein 19
3swp_A2e-32516820173NAC domain-containing protein 19
3swm_D2e-32516820173NAC domain-containing protein 19
3swm_C2e-32516820173NAC domain-containing protein 19
3swm_B2e-32516820173NAC domain-containing protein 19
3swm_A2e-32516820173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026861e-100CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAL1386411e-100AL138641.2 Arabidopsis thaliana DNA chromosome 3, BAC clone T22K7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404466.10.0hypothetical protein EUTSA_v10010503mg
SwissprotQ9M2901e-123NAC61_ARATH; Putative NAC domain-containing protein 61
TrEMBLV4LQ380.0V4LQ38_EUTSA; Uncharacterized protein
STRINGBra019442.1-P1e-142(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14452893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.21e-126NAC domain containing protein 61