PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10010450m
Common NameEUTSA_v10010426mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 382aa    MW: 41935.1 Da    PI: 5.9039
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10010450mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.4e-13228282357
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                      ++kr+rr+ +NRe+ArrsR+RK++++ e  +  ++    N+ L+  +e+l+ +v+
  Thhalv10010450m 228 DVKRARRMLSNRESARRSRRRKQEQMNEFDTQYDAAAVDNRILRADIETLRTKVK 282
                      68************************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-10226290IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-10227288No hitNo description
PROSITE profilePS5021710.392228291IPR004827Basic-leucine zipper domain
PfamPF001701.4E-10229282IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.9E-9229282No hitNo description
PROSITE patternPS000360233248IPR004827Basic-leucine zipper domain
PfamPF124989.9E-13276327IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MHIVFSVDDL TESFWPASAP VPEPPQNMAD GMTRSQSEWA FQRLIQEMSG SDASPTTNVI  60
DRSPPQVQSE QSLSTIDETS DVVEIQKPPQ NHRLPPGDDQ RDRNRARSSD PLDSAGVDPN  120
QYHAILKSRL DLACAAVARR VGTVKPEDSS SSAGNQKQSL PTRPQAQGSI VAQTSPGASS  180
VGFVPSISTQ KKADVPARQT TSISSRDDSD DDDLDGDTET ADNGDPTDVK RARRMLSNRE  240
SARRSRRRKQ EQMNEFDTQY DAAAVDNRIL RADIETLRTK VKMAEETVKR VTGVNPLHWA  300
ARPNMGIPLN NTPTDSSRIQ PNSNHILKPA IPSTTGAGLA PNQRVERGNF LGEQVNREGI  360
QNPFAPDSNL YETLPHWNHK H*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242249RRSRRRKQ
2244249SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530610.0AK353061.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-20-B05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403554.10.0hypothetical protein EUTSA_v10010426mg
SwissprotQ9M1G61e-179BZP25_ARATH; Basic leucine zipper 25
TrEMBLV4LRD10.0V4LRD1_EUTSA; Uncharacterized protein
STRINGscaffold_502576.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.11e-176basic leucine zipper 25