PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10010340m
Common NameEUTSA_v10010340mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 471aa    MW: 52606.4 Da    PI: 6.9299
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10010340mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.82.6e-50131411128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lp+G+rF+Ptd+elv +yL++k++g+++++ ++i+e+di+k+ePwdLp  + +k++++ew fF++ d+ky++g+r+nrat +gyWkatgkd+++
  Thhalv10010340m  13 LPVGLRFRPTDQELVRFYLRRKINGHDNDV-KAIREIDICKWEPWDLPdfSVIKTKDSEWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKI 105
                      799************************999.89***************6448889999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s k++ +g+k+tLvf++grapkg++t+W++heyr+
  Thhalv10010340m 106 RSDKDNIIGVKRTLVFHSGRAPKGTRTNWIIHEYRA 141
                      **********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.98E-569164IPR003441NAC domain
PROSITE profilePS5100554.11113164IPR003441NAC domain
PfamPF023652.2E-2314140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MNPNIEVLSL DSLPVGLRFR PTDQELVRFY LRRKINGHDN DVKAIREIDI CKWEPWDLPD  60
FSVIKTKDSE WLFFCPLDRK YPNGSRQNRA TIAGYWKATG KDRKIRSDKD NIIGVKRTLV  120
FHSGRAPKGT RTNWIIHEYR ATEKDLSGTN PGQSPFVICK LFKKQDLSLA EEDSKLDEAE  180
PAVSSPAVAA SSPDDTKSEV SMVAKTEDVK RCDIAESSLV ISGDPHSGAC DEATTAELGH  240
LDWLSFPELE SVNYKLFSPL HSQVQSELGS SFIAIQPGSS DFSGNHNNNS FQIQTQYGTN  300
EVDTYISDFL DSILDLPDEV PEKQKFVLQS GPDQIAPAYQ QRPAGDMSND VSRTGITLKT  360
RREQQSSGCT TDYIMHGNAS RRLRLQSKLN DVNSKDTELQ IIKREVEDTV GETMKKGKPM  420
RSKNRTGFLF KKMVSVKCSY GGLLRAAIVA VLFLMSVCSL TSDFRASVMI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-46816512166NAC domain-containing protein 19
4dul_A2e-46816512166NAC domain-containing protein 19
1ut7_B2e-46816512166NO APICAL MERISTEM PROTEIN
1ut7_A2e-46816512166NO APICAL MERISTEM PROTEIN
1ut4_B2e-46816512166NO APICAL MERISTEM PROTEIN
1ut4_A2e-46816512166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAPTransfer from AT3G49530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404132.10.0hypothetical protein EUTSA_v10010340mg
SwissprotQ9SCK60.0NAC62_ARATH; NAC domain-containing protein 62
TrEMBLV4L5I20.0V4L5I2_EUTSA; Uncharacterized protein
STRINGscaffold_501948.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24162873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.10.0NAC domain containing protein 62