PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10009710m
Common NameEUTSA_v10009710mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 281aa    MW: 31829.4 Da    PI: 5.5024
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10009710mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.52.6e-17196253259
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                      ++ +r++r++kNRe+A rsR+RK+a++ eLe+ v++Le+eN++L ke+e   ke +k 
  Thhalv10009710m 196 AAAQRQKRMIKNRESAARSRERKQAYQVELETLVAKLEQENEQLLKEIEDKAKERYKN 253
                      5789********************************************9888887764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000411.0E-5729IPR001630cAMP response element binding (CREB) protein
PRINTSPR000411.0E-5194210IPR001630cAMP response element binding (CREB) protein
Gene3DG3DSA:1.20.5.1705.7E-14194256No hitNo description
SMARTSM003388.6E-14195260IPR004827Basic-leucine zipper domain
PfamPF001702.9E-16196255IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.254197249IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.94E-11199250No hitNo description
CDDcd147072.45E-17199244No hitNo description
PROSITE patternPS000360202217IPR004827Basic-leucine zipper domain
PRINTSPR000411.0E-5212232IPR001630cAMP response element binding (CREB) protein
PRINTSPR000411.0E-5232249IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MASFKLMSSS NSRNSDLSRR NSSSASSSPS VRSNHLRHSD HSRITFGYGG VNDVTTLHDY  60
NFAFDPNLME TAIDLDRSNG DRNSVNGGRK SVDDVWKEIV SGEKKTIMKE EAVAQEEDTM  120
TLEDFLAKAA SAMDDDDDDS DEIDVKIPPE RLSYTTFDYP MMQQHNPFQM TEGSNGGGMR  180
GKRGRVMMVE AAMDKAAAQR QKRMIKNRES AARSRERKQA YQVELETLVA KLEQENEQLL  240
KEIEDKAKER YKNLMEQLIP VDEKPRALSR SFSRSHSLEW *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006418183.10.0hypothetical protein EUTSA_v10009710mg
SwissprotP427771e-115GBF4_ARATH; G-box-binding factor 4
TrEMBLV4MW790.0V4MW79_EUTSA; Uncharacterized protein
STRINGBra015281.1-P1e-116(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.19e-85G-box binding factor 4