PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10009681m
Common NameEUTSA_v10009681mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 475aa    MW: 52725.7 Da    PI: 6.3887
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10009681mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.42.7e-07154216163
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++ +
  Thhalv10009681m 154 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLETIN 216
                      78899******************************************9999999999888766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001703.7E-7154216IPR004827Basic-leucine zipper domain
SMARTSM003382.7E-9154218IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979156219IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.41E-6158213No hitNo description
Gene3DG3DSA:1.20.5.1703.7E-7158224No hitNo description
CDDcd147021.20E-12164210No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MELEPISSCC SSSSPSVPSS SSSGEEAADM TELEAAEALA DLAQLAIMRE QVFESAASWG  60
SKGKRVRKRV KTESPPCDSR LKPADSETLP TLDLAEGRAV KDEEDEVQPI TREVTKVPVK  120
TEVTDEIPKP NIASTLRCRS SGCGRSRQNL SEAEREERRI RRILANRESA RQTIRRRQAM  180
CEELSKKAAD LTYENENLRR EKDWALKEFQ SLETINKHLK EQVSKSAKLD TKEPEESPKP  240
SQVEMSTSST PFYFYNQNPY QLFCWPHVTQ SSNPVISPLE TQNGFAAPFT TVGGASAKTM  300
TSQEHGNPAD DNGQKTHFYV VPCPWFLPAP DQSNGVPFAF QDPQRVIPSN GHHIDDSSAN  360
SVEVKKSLPS HLQTRIKEED SGSPEARPLY DLNESATEVL SEGGDGFPVT QQAYSFKHED  420
VSDSPNGVTA MQPGHHVLIS LPGKKHGSLA AAEARRRRKE LTRLKNLHGR QCRMQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1454459RRRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416500.10.0hypothetical protein EUTSA_v10009681mg, partial
TrEMBLV4L5160.0V4L516_EUTSA; Uncharacterized protein (Fragment)
STRINGAT1G19490.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein