PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10008371m
Common NameEUTSA_v10008371mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 291aa    MW: 32920.2 Da    PI: 6.7894
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10008371mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.12.9e-5261301128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv++yL++k++++++++  +i+e+d+yk++Pw+Lp  +  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg dk++ +
  Thhalv10008371m   6 LPPGFRFHPTDEELVMHYLCRKCASQSISV-PIIAEIDLYKYDPWELPGLALYGEKEWYFFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGV 98 
                      79****************************.88***************6555679*************************************99 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + vg+kk Lvfy g+apkgekt+W+mheyrl
  Thhalv10008371m  99 --PKPVGIKKALVFYAGKAPKGEKTNWIMHEYRL 130
                      ..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-623157IPR003441NAC domain
PROSITE profilePS5100560.4496157IPR003441NAC domain
PfamPF023651.2E-277130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MSELQLPPGF RFHPTDEELV MHYLCRKCAS QSISVPIIAE IDLYKYDPWE LPGLALYGEK  60
EWYFFSPRDR KYPNGSRPNR SAGSGYWKAT GADKPIGVPK PVGIKKALVF YAGKAPKGEK  120
TNWIMHEYRL ADVDRSVRKK KNSLRLDDWV LCRIYNKKGA LERRGPPPPE VHGGGVTDEA  180
VEEKPRLTEM GMPPPPQQTA NEFVYFDTSD SVPKLHTTES SCSEHVVSPE FTSEVQSEPK  240
WKDWSAATNG NNTLDFGYNY MDATVDNAFG GGSNQMFPLQ DMFMYMQKPY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-80216311174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531820.0AK353182.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-31-F07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006418449.10.0hypothetical protein EUTSA_v10008371mg
SwissprotQ390130.0NAC2_ARATH; NAC domain-containing protein 2
TrEMBLE4MXD50.0E4MXD5_EUTHA; mRNA, clone: RTFL01-31-F07
TrEMBLV4L3D90.0V4L3D9_EUTSA; Uncharacterized protein
STRINGAT1G01720.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.10.0NAC family protein