PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10008226m
Common NameEUTSA_v10008226mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 321aa    MW: 36761.3 Da    PI: 8.4641
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10008226mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.41.4e-5381361128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeel+++yLkkk++ +k+e+ evi+evd++k+ePwdL+   ++ +  ++ewyfFs++d+ky+tg+r+nrat+sg+Wkatg+dk 
  Thhalv10008226m   8 VPPGFRFHPTDEELLHYYLKKKISYEKFEM-EVIREVDLNKIEPWDLQDrcRIGStPQNEWYFFSHKDRKYPTGSRTNRATHSGFWKATGRDKC 100
                      69****************************.99**************952433332556*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + s   +++g++ktLvfykgrap+g+ktdW+mheyr+
  Thhalv10008226m 101 IRS-CYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRI 136
                      **9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-597156IPR003441NAC domain
PROSITE profilePS5100557.9468156IPR003441NAC domain
PfamPF023653.9E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSSLNGGVPP GFRFHPTDEE LLHYYLKKKI SYEKFEMEVI REVDLNKIEP WDLQDRCRIG  60
STPQNEWYFF SHKDRKYPTG SRTNRATHSG FWKATGRDKC IRSCYKKIGM RKTLVFYKGR  120
APHGQKTDWI MHEYRIEDTD DEPSEDGWVV CRVFKKKNLF KVGNDAGSRI NNNNRLEVRS  180
FVHKESPYHG TVTFELNKPG EIGLHQNQPP MFQSQAILTS THHNKPLSIG YDHNLALLPR  240
ESESDGIQYQ QACETSGVGV GTCKSVGEWG IVACHMGNQN HQEPSRAMRF EYEGNNNSSL  300
VQPPSNLLSL RGENSFLGLF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-50815815170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0270353e-83AC027035.5 Arabidopsis thaliana chromosome 1 BAC T16O9 genomic sequence, complete sequence.
GenBankCP0026843e-83CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415110.10.0hypothetical protein EUTSA_v10008226mg
SwissprotQ9C8780.0BRN1_ARATH; Protein BEARSKIN1
TrEMBLV4L1400.0V4L140_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__3458__AT1G33280.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52132648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33280.10.0NAC domain containing protein 15