PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10008146m
Common NameEUTSA_v10008146mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 336aa    MW: 36882 Da    PI: 5.421
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10008146mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.3e-10149198554
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                      kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l   + 
  Thhalv10008146m 149 KRAKRILANRQSAARSKERKARYIQELERKVQSLQTEATTLSAQLTLFQR 198
                      9****************************************998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-16145209IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909147210IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-10149200No hitNo description
Gene3DG3DSA:1.20.5.1706.7E-8149194No hitNo description
PfamPF001703.1E-8149197IPR004827Basic-leucine zipper domain
CDDcd147035.48E-23150199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MEKSDPPPPK PAALIPSDPH PNPNADPVPS SFHRRSRSDD MSMFMFMDPL ISSSGAPPSS  60
DDLPSDDDLF SSFIDVDSLS SNPHPPLSFP NPSSNNSVPP PTSSSSSRPR HRHSNSVDAG  120
CAMYASEIMD AKKAMPPEKL SELWNIDPKR AKRILANRQS AARSKERKAR YIQELERKVQ  180
SLQTEATTLS AQLTLFQRDT NGLANENTEL KLRLQAMEQQ AQLRNALNEA LRKEVERMKM  240
ETGEISGNSD SYDMGMQQIQ YSPSTFMAIP PYHGSTNGQD MQMHGFNPME MSNSQSVSEF  300
LQNGRLQGLD ISSNSSSLVK SEGPSLSASE SSSAY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00129DAPTransfer from AT1G06850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0001020.0BT000102.1 Arabidopsis thaliana Similar to bZIP transcription factors (At1g06850) mRNA, complete cds.
GenBankAY0624740.0AY062474.1 Arabidopsis thaliana Similar to bZIP transcription factors (At1g06850; F4H5.7) mRNA, complete cds.
GenBankAJ4198520.0AJ419852.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417873.10.0hypothetical protein EUTSA_v10008146mg
SwissprotQ6S4P42e-83RF2B_ORYSJ; Transcription factor RF2b
TrEMBLV4MVL20.0V4MVL2_EUTSA; Uncharacterized protein
STRINGBra030663.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-133basic leucine-zipper 52