PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10007954m
Common NameEUTSA_v10007954mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 376aa    MW: 43146.6 Da    PI: 6.6562
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10007954mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.81.4e-23953145
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     kr e+ snrqvt+skR+ gilKKA+ELS+LCd+++ +++fs+tgk
  Thhalv10007954m  9 KRLESASNRQVTYSKRKSGILKKAKELSILCDIDIVLLMFSPTGK 53
                     6899****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.0E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.203161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.15E-26295IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-19323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-201157IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MGRVKLKIKR LESASNRQVT YSKRKSGILK KAKELSILCD IDIVLLMFSP TGKPNVFHGE  60
HSCIEDVITK FAQLTPQERT KRKLESLEGL KKTFKKLDHD VNINEFLGAR NQTIEGLSNQ  120
VAIFQAQLME CHRRLSCWTN IDRIENTEHL NLLEESLRKS LERIQIHKEH YRKNQLLPIE  180
CTTTQFHSGI QLPLAMGGNN SMQEAHSMSW LPDNENQQTI LPGDSSFLPH RDMDGSIPVY  240
SNCFFETTKP EDQICSNPGQ QFEHLEQQGN GCLGLQQLGE EYPYPTPFGT SLGMEEDQDK  300
KIKCEMELNN LQEQQKPSSM YDPTVNNSGF FQIPHDQSMF ATDHHHHQHH HHQNWVPDSM  360
FGQTSYSQVC VSHHQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A8e-14192190MEF2 CHIMERA
6byy_B8e-14192190MEF2 CHIMERA
6byy_C8e-14192190MEF2 CHIMERA
6byy_D8e-14192190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10007954m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1431720.0AY143172.1 Arabidopsis thaliana MADS-box protein AGL65 (AGL65) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416569.20.0agamous-like MADS-box protein AGL65
SwissprotQ7X9I00.0AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLV4KY080.0V4KY08_EUTSA; Uncharacterized protein
STRINGXP_006416569.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.10.0AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]