PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10007844m
Common NameEUTSA_v10007844mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family G2-like
Protein Properties Length: 394aa    MW: 44161.8 Da    PI: 7.9669
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10007844mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32219272255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Thhalv10007844m 219 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 272
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15216272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28217272IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23219272IPR006447Myb domain, plants
PfamPF002492.6E-7220271IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQKRRS TTDQEGHEEL DLGFWRRALD SRTSSLVSNS  60
SSKTTNNHHH HPLEDLSLSN NSHHQHHPHL LPSCNSSNIL TSFQFQTQQQ QQLQGFLAHD  120
LNTHLRPIRG IPLYQNPPPN HHHRPPPCFP FDPSSLIPSS SPAPTGINNN NSFGTSGVSN  180
SGLITNPSYH NHQHQHHHQT LNRTRFMPRF PAKRSMRAPR MRWTTTLHAR FVHAVELLGG  240
HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKTTDKAA ASSGQSDVYE NGSSGDNNSD  300
DWMFDMNRKS RDSDELTNPL EKSNGLWTNS SGEARLHGKL IDNVAEIMLP SEKEVDGKCS  360
SYERISSEEM SSSSISGTSP FKPNLEFTLG RSH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415234.10.0hypothetical protein EUTSA_v10007844mg
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLV4KU900.0V4KU90_EUTSA; Uncharacterized protein
STRINGBra023254.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-164G2-like family protein