PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10007692m
Common NameEUTSA_v10007692mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 431aa    MW: 47540.4 Da    PI: 6.3816
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10007692mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.95.9e-10210266561
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                      kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l  
  Thhalv10007692m 210 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLSV 266
                      9*******************************************9999877666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.6E-15206270IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657208271IPR004827Basic-leucine zipper domain
PfamPF001701.3E-8210262IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-11210261No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-10210264No hitNo description
CDDcd147032.65E-24211260No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MDKEKSPAPP SGGLPPPSGR YSAFSPNGSG FPIKSESSFP HLTPSGSSSD ANRFSHDISR  60
MLDNPPKNLG HRRAHSEILT LPDDLSFDSD LGVVGAADGP SFSDETDEDL LYMYLDMDKF  120
NSSATSSSQM GEPSEPAWRN ELGSTSNLQS TPGSSSERPR IRHQHSQSMD GSTTIKPEML  180
MSGNEDVPGV DSKKAISAAK LSELALIDPK RAKRIWANRQ SAARSKERKM RYIAELERKV  240
QTLQTEATSL SAQLTLLQRD TNGLSVENND LKLRVQTMEQ QVHLQDALND ALKEEVQHLK  300
VLTGQGVSNG ASMMNYGSYG SNQQFYPNNQ SMHTMLAAQQ LQQLQIHSQK QQQQQQQQQQ  360
QQQQQQQQQQ QQQQQFQFSS NNFISFISAA AAANPQQDTK RCHGAEKAHV SSVQKENVTS  420
PDLEVPSTKD *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533810.0AK353381.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417960.10.0hypothetical protein EUTSA_v10007692mg
SwissprotQ040880.0POF21_ARATH; Probable transcription factor PosF21
TrEMBLV4L9630.0V4L963_EUTSA; Uncharacterized protein
STRINGscaffold_100594.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.10.0bZIP family protein