PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10007021m
Common NameEUTSA_v10007021mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 655aa    MW: 73790.7 Da    PI: 5.6013
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10007021mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.52.5e-53151421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lp GfrF+Ptdeel+++yL+ k++g++le+ +vi+e+d++k+ePwdLp  + +k++++ew+fF++rd+ky++g+r+nrat+ gyWkatgkd+++
  Thhalv10007021m  15 LPLGFRFRPTDEELINHYLRLKINGRDLEV-RVIPEIDVCKWEPWDLPglSVIKTDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTI 107
                      699***************************.99***************6448899999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +s k+  +g+kktLvfy+grap+ge+t+W+mheyr+
  Thhalv10007021m 108 KS-KKMIIGMKKTLVFYRGRAPRGERTNWIMHEYRA 142
                      **.9999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-646165IPR003441NAC domain
PROSITE profilePS5100558.70215165IPR003441NAC domain
PfamPF023652.1E-2716141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MTTTETQAAL SMESLPLGFR FRPTDEELIN HYLRLKINGR DLEVRVIPEI DVCKWEPWDL  60
PGLSVIKTDD QEWFFFCPRD RKYPSGHRSN RATDIGYWKA TGKDRTIKSK KMIIGMKKTL  120
VFYRGRAPRG ERTNWIMHEY RATDKDLDGT GPGQNPYVLC RLFHKPNDSC DVANCDEVEN  180
VNSTPTATRC SPDDTSSDMV QETATSHVHA QNKSDDTANC PSDKGSDVKP EDPVIKTEKS  240
VDHGETSRAK DRNLGKSLAA ENANVRDFAT LCGPSSTQNC DQAYYPDQSS IGFAASHMDS  300
MYSSDFGNHD FGNCDYGLHF QDGAALKDDE SLQDVLDEVF HINNQSSSER KDFTLPNMMH  360
WPGNPKLLST EYPFPKDTDA FGNGPQHFVP DTIASRWVSN HHVDSKEGVD MQSSSGSSRT  420
LTPLHSNVLG QYASASYAAM DPFNSNVNQR DQSSFEQNPV DRNISPSDIS GFNARSQENQ  480
TDLDSVVNQG TAPRRIRLQI EQPRNADTYE EDEVQSAMSK VIEEHEKCFL DRDKTRAQGH  540
ESLSESANIR TQGTAHRRIR LQTRLQKLPI NPRDSKCNEE EEANHSKCEM QEKEDVSSSS  600
WQKQKKLMRS LVQCSTMVIV MAVIVVLVGI WKESTDAKCS FLFHQLDSFK GMFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-471016915172NAC domain-containing protein 19
3swm_B2e-471016915172NAC domain-containing protein 19
3swm_C2e-471016915172NAC domain-containing protein 19
3swm_D2e-471016915172NAC domain-containing protein 19
3swp_A2e-471016915172NAC domain-containing protein 19
3swp_B2e-471016915172NAC domain-containing protein 19
3swp_C2e-471016915172NAC domain-containing protein 19
3swp_D2e-471016915172NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382690.0KF738269.1 Brassica napus NAC transcription factor 14 (NAC14.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415127.10.0hypothetical protein EUTSA_v10007021mg
SwissprotB5X5700.0NAC14_ARATH; NAC domain-containing protein 14
TrEMBLV4K7D20.0V4K7D2_EUTSA; Uncharacterized protein
STRINGBra010193.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.20.0NAC 014