PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006790m
Common NameEUTSA_v10006790mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family Nin-like
Protein Properties Length: 846aa    MW: 94601.9 Da    PI: 5.5091
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006790mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.84.9e-29556606252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Thhalv10006790m 556 DKTITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 606
                      689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.188540626IPR003035RWP-RK domain
PfamPF020423.3E-25558606IPR003035RWP-RK domain
SuperFamilySSF542775.89E-23735833No hitNo description
SMARTSM006664.9E-26745828IPR000270PB1 domain
PROSITE profilePS5174527.448745828IPR000270PB1 domain
PfamPF005645.2E-19746827IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.2E-20746825No hitNo description
CDDcd064071.61E-41746826No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 846 aa     Download sequence    Send to blast
MEDSFLQSEN AVMDTEFMDG LLLDGCWLET TDGSEFLNLP PSTSSDSPFD PSSLMWSPTQ  60
DTSALCTSGI VYGRDSAERS SLDEFQWNKR WWIGPGGGGS SVTERLVQAV EHIKDYTTER  120
GSLIQLWVPV NRGGKRVLTT KEQPFSHDPM CQRLANYREI SVNYHFSAEQ DDSKALAGLP  180
GRVFLGKLPE WTPDVRFFRS EEYPRVQHAQ DCDVRGTLAI PVFEQGSKIC LGVIEVVMTT  240
EMVKLRPELE SICRALQAVD LRSTELPIPP SLKGCDLSYK AALPEIRNLL RCACETHKLP  300
LAQTWVSCLQ QSKSGCRHND ENYTHCVSTI DDACYVGDPT VREFHEACSE HHLLKGQGVA  360
GQAFLTNGPC FSSDISNYKK SEYPLSHHAN MFGLHGSVAI RLRCIHTGSA DFVLEFFLPK  420
DCDDLEEQRK MLNALSTIMA HVPRSLRTVT DKELEEESEV IEREETVTPK IENTSELHHL  480
HGNSSWSASF DEIQQSNNSN NPQNLGLVFD GGEKPNDGFG LKRGFDYTRD SNVNESSTFS  540
TDGFSRMTEK KRTKADKTIT LDVLRQYFAG SLKDAAKNIG VCPTTLKRIC RQHGIQRWPS  600
RKIKKVGHSL QKIQRVIDSV EGVSGPLQIG SFYANFPNLA SQSQEPSQQA KTSPPPQPPL  660
QPAKSPVSPY SHSSNSSQCC SSETQLNSGA TTDPSQADVG GAMKKRSSEI DLQSSSLDET  720
VLTLSTLENI PQGTHMLSSS QDDDFLRIKV SYGEENIRFR MRNSHRLTDL LWEIGKRFSI  780
EDMSRYDLKY LDEDNEWVLL TCDEDVDECV DVCRTTPSHT IKLLLHVSSH HFPERSSATG  840
YSLWH*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10006790m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416377.10.0protein NLP4
RefseqXP_024008321.10.0protein NLP4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLV4KAM40.0V4KAM4_EUTSA; Uncharacterized protein
STRINGXP_006416377.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein