PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006418m
Common NameEUTSA_v10006418mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 147aa    MW: 16757 Da    PI: 5.3721
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006418mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.62.3e-122583563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     ++ +r+++NRe+ArrsR RK++++  L ++v  L++ N +  ++++  + ++ +++s++
  Thhalv10006418m 25 RKRKRMISNRESARRSRMRKQKQLGDLINEVTLLKNDNAKITEQVDAATRKYVEMESKN 83
                     6789*********************************************9999999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-152185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.5992386IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-112577No hitNo description
PfamPF001707.5E-112583IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-102579No hitNo description
CDDcd147025.05E-162676No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MGSLQRQTSP DSDNDPRYAT VTDERKRKRM ISNRESARRS RMRKQKQLGD LINEVTLLKN  60
DNAKITEQVD AATRKYVEME SKNNVLRAQA LELTDRLRSL NSVLEMVEEI SGQALDIPEI  120
PESMQNPWQI SCPMQPIMAA ADMFEC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12445RKRKRMISNRESARRSRMRKQK
23744RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026861e-156CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAY0914211e-156AY091421.1 Arabidopsis thaliana putative bZIP transcription factor (At3g62420) mRNA, complete cds.
GenBankAY0509231e-156AY050923.1 Arabidopsis thaliana putative bZIP transcription factor (At3g62420) mRNA, complete cds.
GenBankAL1625071e-156AL162507.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T12C14.
GenBankAF4006201e-156AF400620.1 Arabidopsis thaliana transcription factor-like protein bZIP53 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402377.11e-104hypothetical protein EUTSA_v10006418mg
SwissprotQ9LZP82e-97BZP53_ARATH; bZIP transcription factor 53
TrEMBLV4L0P01e-104V4L0P0_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.5__2740__AT3G62420.14e-97(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.11e-98basic region/leucine zipper motif 53