PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006408m
Common NameEUTSA_v10006408mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 267aa    MW: 30651 Da    PI: 7.4106
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006408mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM117.51.3e-36491732128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                       pGfrF+Ptdeelv +yL++  +++  +    +++v+iy+++P++L +++++ + +ew+f s+r + ++ gkr+nr+ + gyW+atg+ ++ ++
  Thhalv10006408m  49 RPGFRFSPTDEELVLHYLEPFSKSRASSW--PVHHVNIYESNPQRLSAEYEKgNLTEWFFVSERTNMHKGGKRQNRSDNGGYWHATGTATKFKA 140
                      59******************999999766..79*************9655551555************************************99 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ +vg k +Lv+y+gr+p+g+kt+W+++ey l
  Thhalv10006408m 141 -GNGVVGNKASLVYYTGRQPNGVKTNWLIKEYWL 173
                      .9999***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-4044194IPR003441NAC domain
PROSITE profilePS5100538.26748194IPR003441NAC domain
PfamPF023652.9E-1950172IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MVPDQRNKGK EKCSPEPQTQ PQSLKHDPDM PSSSSSAPSY LSPRDHVCRP GFRFSPTDEE  60
LVLHYLEPFS KSRASSWPVH HVNIYESNPQ RLSAEYEKGN LTEWFFVSER TNMHKGGKRQ  120
NRSDNGGYWH ATGTATKFKA GNGVVGNKAS LVYYTGRQPN GVKTNWLIKE YWLDPSSSDD  180
NMTVGYALYK IYQTPVTKKK KKEEGVEALK EDPLDINEYQ QSYQPQFWPT TLDSHQCQPH  240
GIVYHQPQLL DTNEYHQPHQ PQPLDIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-215020019171NO APICAL MERISTEM PROTEIN
1ut4_B1e-215020019171NO APICAL MERISTEM PROTEIN
1ut7_A1e-215020019171NO APICAL MERISTEM PROTEIN
1ut7_B1e-215020019171NO APICAL MERISTEM PROTEIN
3swm_A1e-215019322167NAC domain-containing protein 19
3swm_B1e-215019322167NAC domain-containing protein 19
3swm_C1e-215019322167NAC domain-containing protein 19
3swm_D1e-215019322167NAC domain-containing protein 19
3swp_A1e-215019322167NAC domain-containing protein 19
3swp_B1e-215019322167NAC domain-containing protein 19
3swp_C1e-215019322167NAC domain-containing protein 19
3swp_D1e-215019322167NAC domain-containing protein 19
4dul_A1e-215020019171NAC domain-containing protein 19
4dul_B1e-215020019171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402976.10.0hypothetical protein EUTSA_v10006408mg, partial
TrEMBLV4LKZ60.0V4LKZ6_EUTSA; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.5__2087__AT3G56530.17e-62(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27931563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56530.13e-60NAC domain containing protein 64