PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006124m
Common NameEUTSA_v10006121mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 300aa    MW: 32461.7 Da    PI: 9.991
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006124mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.49.6e-16229271547
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                      +r++r++kNRe+A rsR+RK+a++ eLe kv  Le+eN++L+ 
  Thhalv10006124m 229 RRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENERLRR 271
                      79***************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.4E-14222272No hitNo description
SMARTSM003381.3E-12225297IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.427227272IPR004827Basic-leucine zipper domain
CDDcd147073.55E-23229283No hitNo description
SuperFamilySSF579592.5E-10229274No hitNo description
PfamPF001701.2E-12229272IPR004827Basic-leucine zipper domain
PROSITE patternPS000360232247IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MQFPRLSQIA ITRQGSLYSL TLDEVQNHLG SSGKALGSMN LDELLKSVCS VEGNQPSSMT  60
VNGAAAAQEG LSRQGSLTLP RDLSKKTVDE VWKDIQQNKN GGNAHERRDK QPTLGEMTLE  120
DLLLKAGVVT ETIPGSNQDG PGGGPGCGPG GVSAGSGAGL GQNITQVGPW VQYHQLPSMP  180
QPQAFMPYPV SDMQAMVSQS SLMGGLSDTQ TPGRKRVASG EVVEKTVERR QKRMIKNRES  240
AARSRARKQA YTHELEIKVS RLEEENERLR RQKEVEKILP SAPPPDPKRQ LRRTSSAPF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0816700.0AY081670.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850) mRNA, complete cds.
GenBankAY0624480.0AY062448.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850; T8M16_180) mRNA, complete cds.
GenBankAB0171620.0AB017162.1 Arabidopsis thaliana mRNA for ABA-responsive element binding protein 3 (AREB3), complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402942.10.0hypothetical protein EUTSA_v10006121mg
SwissprotQ9LES30.0AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLV4L2750.0V4L275_EUTSA; Uncharacterized protein
STRINGAT3G56850.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-173ABA-responsive element binding protein 3