PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006121m
Common NameEUTSA_v10006121mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 305aa    MW: 32975.1 Da    PI: 9.6393
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006121mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.49.9e-16234276547
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                      +r++r++kNRe+A rsR+RK+a++ eLe kv  Le+eN++L+ 
  Thhalv10006121m 234 RRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENERLRR 276
                      79***************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.5E-14227277No hitNo description
SMARTSM003381.3E-12230302IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.427232277IPR004827Basic-leucine zipper domain
CDDcd147074.49E-23234288No hitNo description
PfamPF001701.3E-12234277IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.56E-10234279No hitNo description
PROSITE patternPS000360237252IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MDSQRGIVEE PKSQSLNRQG SLYSLTLDEV QNHLGSSGKA LGSMNLDELL KSVCSVEGNQ  60
PSSMTVNGAA AAQEGLSRQG SLTLPRDLSK KTVDEVWKDI QQNKNGGNAH ERRDKQPTLG  120
EMTLEDLLLK AGVVTETIPG SNQDGPGGGP GCGPGGVSAG SGAGLGQNIT QVGPWVQYHQ  180
LPSMPQPQAF MPYPVSDMQA MVSQSSLMGG LSDTQTPGRK RVASGEVVEK TVERRQKRMI  240
KNRESAARSR ARKQAYTHEL EIKVSRLEEE NERLRRQKEV EKILPSAPPP DPKRQLRRTS  300
SAPF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0816700.0AY081670.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850) mRNA, complete cds.
GenBankAY0624480.0AY062448.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850; T8M16_180) mRNA, complete cds.
GenBankAB0171620.0AB017162.1 Arabidopsis thaliana mRNA for ABA-responsive element binding protein 3 (AREB3), complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402943.10.0hypothetical protein EUTSA_v10006121mg
SwissprotQ9LES30.0AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLV4NE970.0V4NE97_EUTSA; Uncharacterized protein
STRINGAT3G56850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.10.0ABA-responsive element binding protein 3