PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006090m
Common NameEUTSA_v10006090mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 332aa    MW: 37141.6 Da    PI: 6.9147
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006090mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.21.1e-10206249548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  +
  Thhalv10006090m 206 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSVLSPR 249
                      899********************************998777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-13202266IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.588204256IPR004827Basic-leucine zipper domain
PfamPF001703.0E-9206250IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-13206257No hitNo description
SuperFamilySSF579592.49E-11206260No hitNo description
CDDcd147033.71E-23207257No hitNo description
PROSITE patternPS000360209224IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MAQLPPKIPT MTTTTTPHWP DFSSQKLPSI AATAVATAVT AGQQNNPSWM DEFLDFSATR  60
RGTHRRSISD SIAFLEAPSS GVGNHHFDRF DDEQFMSMFN DDVHQQNHNN NNNHHNHHHN  120
NVGPTRSSSN TSTPSDHNSL SDDDNKEPPP SDHNHMDTTA NQNNVAGNNY NESDEVQSQC  180
KTEPQDGPSA NQNSGGSSGN RIHDPKRVKR ILANRQSAQR SRVRKLQYIS ELERSVTSLQ  240
TEVSVLSPRV AFLDHQRLLL NVDNSAIKQR IAALAQDKIF KDAHQEALKR EIERLRQVYH  300
QQSLKKMENN VSDQSPADIK PSVEKEQLLN A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0087280.0BT008728.1 Arabidopsis thaliana At3g58120 gene, complete cds.
GenBankAY0930530.0AY093053.1 Arabidopsis thaliana pelota-like protein (At3g58120) mRNA, complete cds.
GenBankAY0873560.0AY087356.1 Arabidopsis thaliana clone 34553 mRNA, complete sequence.
GenBankAF4013000.0AF401300.1 Arabidopsis thaliana transcription factor bZIP61 (BZIP61) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402806.10.0hypothetical protein EUTSA_v10006090mg
SwissprotQ9M2K40.0BZP61_ARATH; Basic leucine zipper 61
TrEMBLV4LKJ50.0V4LKJ5_EUTSA; Uncharacterized protein
STRINGAT3G58120.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-156bZIP family protein