PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005827m
Common NameEUTSA_v10005827mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 660aa    MW: 71796.5 Da    PI: 5.832
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005827mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.15.2e-15214275263
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       + kr  r+++NRe+A+ sRqRKk ++eeLeekvk++ +  ++Lk++++    e a+l+++v
  Thhalv10005827m 214 DDEKRNARLIRNRESAQLSRQRKKHYVEELEEKVKNMHSTITQLKSKISYFVAENATLRQQV 275
                      5679*********************************************9999999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-17213277IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.553215275IPR004827Basic-leucine zipper domain
PfamPF001705.8E-13216275IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.31E-12217275No hitNo description
Gene3DG3DSA:1.20.5.1704.6E-17217275No hitNo description
CDDcd147046.53E-22218269No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MAEPVMVEKN HTPDTDPSTP CFSSEFDSIA NPPPPFADNF YNSSSDRALI GKPISDLRFL  60
IDGDGDFELI FDSVDDLYFP SENESFVIPV GATNGEISGD FTPVTRISGD RVLCCNLESP  120
RDSDCSGTAR SLSLSSQESA NGVSDVSEAT IASSVSGIVA VDQKFKTEEE ASTTSTRKRK  180
KESEEETSED SRNSKYRRSD EDGVASIVTG GEEDDEKRNA RLIRNRESAQ LSRQRKKHYV  240
EELEEKVKNM HSTITQLKSK ISYFVAENAT LRQQVGSGRG MCWKPSGMYP PLAPMPYPWM  300
PCPAYMAKPQ GSQVPLLPIP RLKPQQSSVA KVKKSEGKTK KVASISVLGL VFCLFLFGAL  360
APILNFSYGG TSGVFYGEYD RLRGRALDVS GHCGRYSDQG VRRNVSATVD SVSLGNGSEP  420
LAASLFVPRN EKLVKIDGNL IIHSVLASEK AMVSVTKNEG QSGVELTKGF SPSLPKHLYS  480
EKQKGLSSSN SDDSSEDQLE STTANGKMQQ WFREGVAGPL FGSGMCTEVF QFDVSSTSGV  540
IIPASPATQQ PKNTTDSYNR KNNRRILRGG LPVSDLNLAK DQNSSSKENF RTSTTKPDPS  600
MVVSMLVDPR EGSDGDTDGT MRGTKSLPRV FVVVLVDGMK YVTYSCLLPR PEVPHLVTT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1176180RKRKK
2176181RKRKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402962.10.0hypothetical protein EUTSA_v10005827mg
SwissprotQ9LXX40.0BZP49_ARATH; bZIP transcription factor 49
TrEMBLV4L2960.0V4L296_EUTSA; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_50017220.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16991911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein