PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005662m
Common NameEUTSA_v10005662mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family Dof
Protein Properties Length: 360aa    MW: 38349.2 Da    PI: 8.3987
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005662mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.1e-3954113362
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      ++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk s
  Thhalv10005662m  54 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPS 113
                      6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3542107IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3255111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.76157111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
EAESSGGSML DSSTTSPSAA DILAACSTRP QASAVAVAAA ALMDGGRRLR PPHDHPQKCP  60
RCESTHTKFC YYNNYSLSQP RYFCKTCRRY WTKGGTLRNI PVGGGCRKNK KPSSSNSSSS  120
TSSGKKPSNI VTTNTSDLMA LAHSHQNYQN GPLGFSHFGG MMGSYSTPEH SNVGFLESKY  180
GGLLSQSPRP IDFLDTKFDL MGVNNDNLVM VDHGSNGDHH HHHNYHMSLN HGVGLNNNNN  240
NGGFHGISPG RNGNGGGALM DVSTCQRLML PNYDHLHYNH NHLEDHQRVT TIMDVKPNAK  300
LLSLDWQHDQ GYSDGGASGG GGKSEGGGYG GGGYINGLGS SWNGLMNGYG SSTKTNSLV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1320327GGKSEGGG
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10005662m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0090530.0AB009053.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MQB2.
GenBankBT0204670.0BT020467.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankBT0205760.0BT020576.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394333.20.0dof zinc finger protein DOF5.6
SwissprotQ9FM031e-164DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLV4KK990.0V4KK99_EUTSA; Uncharacterized protein (Fragment)
STRINGXP_006394333.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-147Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]