PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005552m
Common NameEUTSA_v10005552mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 233aa    MW: 26279.7 Da    PI: 4.6766
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005552mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM81.32.1e-25207870129
              NAM  70 tgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +g+r+nrat sg+Wkatg+dk+++s k+elvg++ktLvfykgrap+g+k+dW+mheyrle
  Thhalv10005552m  20 QGTRTNRATGSGFWKATGRDKAIYS-KQELVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 78 
                      589**********************.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100528.473198IPR003441NAC domain
SuperFamilySSF1019411.18E-30392IPR003441NAC domain
PfamPF023656.9E-122177IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MQADVIKDVG IYKMEPWDIQ GTRTNRATGS GFWKATGRDK AIYSKQELVG MRKTLVFYKG  60
RAPNGQKSDW IMHEYRLETD ENGPPHEEGW VVLSSFQEET NNDELQQSQN TDGIISPRMF  120
QGSSSSSLSS LHHNDNDPYG VVLSTINATP TTSMKRDDEG DHHGHVITNH EDDHMIMMNT  180
SSVDYQDHQT GLLLNDGHND QVMDWQTLEK FVASQLIMSQ EFNKDPSDNS SN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-2117742140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895973e-95AC189597.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH014E13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394399.11e-175hypothetical protein EUTSA_v10005552mg
SwissprotQ9LVA11e-111NC101_ARATH; NAC domain-containing protein 101
TrEMBLV4K1B61e-174V4K1B6_EUTSA; Uncharacterized protein
STRINGAT5G62380.11e-109(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122481732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62380.11e-111NAC-domain protein 101