PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005423m
Common NameEUTSA_v10005423mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 172aa    MW: 19924.1 Da    PI: 5.6657
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005423mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.81.5e-1579137563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      +++rr+++NRe+ArrsR RK+  ++eL   v  L  eN++L ++l++l++  +k+ +e+
  Thhalv10005423m  79 RKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHEKVLQEN 137
                      689***************************************************99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-1475139IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-1177132No hitNo description
PROSITE profilePS5021710.93277140IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.13E-1379129No hitNo description
PfamPF001706.4E-1479137IPR004827Basic-leucine zipper domain
CDDcd147024.09E-1980130No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MQPQDVFSLN NYLNSSIPSP YPSHLPIAST FPINGQNTNP FYGFQSATNN PQSMSLSSNN  60
STSDEAEEQQ TDKNIINERK QRRMISNRES ARRSRMRKQR HLDELWSQVM WLRIENHQLL  120
DKLNNLSESH EKVLQENAQL KEETSELKQV ISDMQIQSPF SCFRDDIIPI E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19198RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAB0168780.0AB016878.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MQP15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395249.11e-123hypothetical protein EUTSA_v10005423mg
SwissprotQ9FMC22e-67BZP43_ARATH; Basic leucine zipper 43
TrEMBLV4K4U21e-123V4K4U2_EUTSA; Uncharacterized protein
STRINGscaffold_501032.11e-104(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-94basic leucine-zipper 42