PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005380m
Common NameEUTSA_v10005380mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 285aa    MW: 33309.7 Da    PI: 8.4156
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005380mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.82.4e-54111371127
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      +ppGfrFhPtdeelv +yLkkkv+++k++l +vi+e+d+yk+ePwdL++  k+  e+kewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v
  Thhalv10005380m  11 VPPGFRFHPTDEELVGYYLKKKVASQKIDL-DVIREIDLYKIEPWDLQErcKIGYEQKEWYFFSHKDKKYPTGTRTNRATVAGFWKATGRDKAV 103
                      69****************************.9***************95346666999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyr 127
                      +  +++l+g++ktLvfy+grap+g+k+dW++hey 
  Thhalv10005380m 104 YL-NSKLIGMRKTLVFYRGRAPNGQKSDWIIHEYY 137
                      **.999***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-596161IPR003441NAC domain
PROSITE profilePS5100557.3711161IPR003441NAC domain
PfamPF023651.3E-2612136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MMGLDQESSS VPPGFRFHPT DEELVGYYLK KKVASQKIDL DVIREIDLYK IEPWDLQERC  60
KIGYEQKEWY FFSHKDKKYP TGTRTNRATV AGFWKATGRD KAVYLNSKLI GMRKTLVFYR  120
GRAPNGQKSD WIIHEYYSLE SHQNYSPPQE EGWVVCRAFK KRSTVPTKRR QRLWDPNCFF  180
YDATLLEPLD KNVLKRAKHN TDFAVTVPFK HIVDDEDLGS MHLHSIDDDQ FSQLPQLESP  240
SLPSDKLPEM ARQSTRALED EKRITDWRSL DKFVATQFLM SGQD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-501016516169NO APICAL MERISTEM PROTEIN
1ut4_B2e-501016516169NO APICAL MERISTEM PROTEIN
1ut7_A2e-501016516169NO APICAL MERISTEM PROTEIN
1ut7_B2e-501016516169NO APICAL MERISTEM PROTEIN
3swm_A2e-501016519172NAC domain-containing protein 19
3swm_B2e-501016519172NAC domain-containing protein 19
3swm_C2e-501016519172NAC domain-containing protein 19
3swm_D2e-501016519172NAC domain-containing protein 19
3swp_A2e-501016519172NAC domain-containing protein 19
3swp_B2e-501016519172NAC domain-containing protein 19
3swp_C2e-501016519172NAC domain-containing protein 19
3swp_D2e-501016519172NAC domain-containing protein 19
4dul_A2e-501016516169NAC domain-containing protein 19
4dul_B2e-501016516169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00590DAPTransfer from AT5G66300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2265100.0DQ226510.1 Thellungiella halophila clone ThBAC2 hypothetical protein genes, complete cds; transposon En/Spm, complete sequence; transposon Gypsy, complete sequence; and transposon AC-like element, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006393830.10.0hypothetical protein EUTSA_v10005380mg
SwissprotQ9FH591e-164NC105_ARATH; NAC domain-containing protein 105
TrEMBLV4MIF30.0V4MIF3_EUTSA; Uncharacterized protein
STRINGBra012065.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151341619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66300.11e-166NAC domain containing protein 105