PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005352m
Common NameEUTSA_v10005352mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 176aa    MW: 20482.2 Da    PI: 9.368
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005352mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.8e-1079138160
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                      +k+++re+rk +NRe+ArrsR + ++ +e  +  + +L+  N++L ++l     +++  k
  Thhalv10005352m  79 DKDDRREKRKKSNRESARRSRMKQQKHLEDVRSQFHQLKRDNRELENQLRYAMHHCQHAK 138
                      689*******************************************99998888888665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-977136No hitNo description
SMARTSM003381.3E-979143IPR004827Basic-leucine zipper domain
PfamPF001708.4E-880138IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.10581127IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.09E-883134No hitNo description
CDDcd147021.23E-1484135No hitNo description
PROSITE patternPS00036086101IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MMSSLSPVFS SEPALASGFT TWDASDLFTI LDDTSLCPVE VNPGPGNTNS CQIQNQCYPN  60
PGFKDKPFNQ TGLNVVLPDK DDRREKRKKS NRESARRSRM KQQKHLEDVR SQFHQLKRDN  120
RELENQLRYA MHHCQHAKIE KDRLRLEHHI LQEKLLNLRQ VLVLRQIQQS STCASW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006393978.11e-130hypothetical protein EUTSA_v10005352mg, partial
TrEMBLV4KJ881e-130V4KJ88_EUTSA; Uncharacterized protein (Fragment)
STRINGscaffold_33400002.16e-72(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.14e-25basic leucine-zipper 5