PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005000m
Common NameEUTSA_v10005000mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 180aa    MW: 20865.3 Da    PI: 6.5326
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005000mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.7e-1383141563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      +++rr+ +NRe+ArrsR RK+  ++eL   v  L +eN  L+++l++ +++ +++ +e+
  Thhalv10005000m  83 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQDSVLKEN 141
                      79************************************************999888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-1479143IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.79581144IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.1E-1081133No hitNo description
SuperFamilySSF579595.42E-1283132No hitNo description
PfamPF001704.7E-1183141IPR004827Basic-leucine zipper domain
CDDcd147022.28E-1784132No hitNo description
PROSITE patternPS00036086101IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MIPAEITGYF QYLSPENLAT IPAEFNIINM PSSPTSSSSL NYLNDLINNN NYSSSSTCQD  60
LMMSNNSASD EDHNQNIIIL DERKQRRMLS NRESARRSRM RKQRHLDELW SQVIRLRNEN  120
NCLIDKLNRV SETQDSVLKE NSKLKEEAFD LRRLVCELKS NKKNINNSNN SFLREFEDV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195102RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00262DAPTransfer from AT2G04038Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0071781e-123AC007178.6 Arabidopsis thaliana chromosome 2 clone F3L12 map mi320, complete sequence.
GenBankCP0026851e-123CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankAB4935451e-123AB493545.1 Arabidopsis thaliana At2g04038 gene for hypothetical protein, partial cds, clone: RAAt2g04038.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395651.11e-126hypothetical protein EUTSA_v10005000mg
SwissprotQ9FMC23e-30BZP43_ARATH; Basic leucine zipper 43
TrEMBLV4KSF31e-126V4KSF3_EUTSA; Uncharacterized protein
STRINGBra017359.1-P3e-88(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04038.12e-69basic leucine-zipper 48