PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004860m
Common NameEUTSA_v10004860mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 232aa    MW: 25903.9 Da    PI: 10.5761
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004860mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.11.1e-14148208161
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                      +ke kr +r+ +NR++A+  R+RKka++  Le+kvk Le++N++L ++l++l++e + l+ 
  Thhalv10004860m 148 DKENKRLKRLLRNRVSAQQARERKKAYLTDLEKKVKDLENKNSELEERLSTLQNENQMLRH 208
                      5899***************************************************998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000414.6E-5147163IPR001630cAMP response element binding (CREB) protein
SMARTSM003385.6E-14148212IPR004827Basic-leucine zipper domain
PfamPF001701.3E-13149209IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.679150213IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.0E-13152210No hitNo description
Gene3DG3DSA:1.20.5.1707.5E-17152212No hitNo description
CDDcd147041.31E-18153204No hitNo description
PROSITE patternPS000360155170IPR004827Basic-leucine zipper domain
PRINTSPR000414.6E-5165185IPR001630cAMP response element binding (CREB) protein
PRINTSPR000414.6E-5185202IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MAHLPPRFTI SNRRFCKRSD GSTLLISFLR NSTRSCWILL PPLASPALFP SFEDRISTEV  60
RKMQEQTTSS LAANSLPSSS ERSSSSAPPL ETKEGMESDE EIRRVPEFGG EITGTENAGR  120
NSASAAGQEQ VQTTGGERQR KRGRSSADKE NKRLKRLLRN RVSAQQARER KKAYLTDLEK  180
KVKDLENKNS ELEERLSTLQ NENQMLRHIL KNTTANKNKR GDNGDGSNPE S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_B3e-17173212342Transcription factor HY5
2oqq_A3e-17173212342Transcription factor HY5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394793.11e-168hypothetical protein EUTSA_v10004860mg
SwissprotO246467e-72HY5_ARATH; Transcription factor HY5
TrEMBLV4KLI91e-167V4KLI9_EUTSA; Uncharacterized protein
STRINGscaffold_601144.14e-70(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56912749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.11e-59bZIP family protein