PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004701m
Common NameEUTSA_v10004701mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 295aa    MW: 32081.5 Da    PI: 5.2327
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004701mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_156.27.3e-18137185351
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      +lkr rr+++NRe+ArrsR+RK++ ++ Le  v++L++eN++L k+l  
  Thhalv10004701m 137 DLKRIRRMYSNRESARRSRRRKQEHLADLESQVDSLKGENSTLYKQLID 185
                      79*****************************************977644 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.8E-13131189No hitNo description
SMARTSM003383.6E-15135199IPR004827Basic-leucine zipper domain
PfamPF001709.4E-15137183IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.139137183IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.76E-12139185No hitNo description
PROSITE patternPS000360142157IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDNRTAKDIG VKRSASELDL QECLMTKALS SSALSRQESI PDTSPLDPSF GLMNQDYTCE  60
LRDSLLLSES LVAAGLFLDA QSSICENLSA DSPVSANKPE ARGRARKTAS GFSHDQSDEE  120
DAETEAGQSE MNNDPNDLKR IRRMYSNRES ARRSRRRKQE HLADLESQVD SLKGENSTLY  180
KQLIDAAQQF RSAGTNNRVL KSDVEALRAK VKLAEDLVAR GSLTSSLNQL LQTHLSPPPQ  240
SINSLHYTRN TSPAITVHSD QSLFPGITLS GQNSSPGLGN VSSEAVSCVS DIWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151158RRSRRRKQ
2153158SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2268730.0AK226873.1 Arabidopsis thaliana mRNA for bZIP protein BZO2H2, clone: RAFL09-07-B02.
GenBankAF3102230.0AF310223.1 Arabidopsis thaliana bZIP protein BZO2H2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394731.10.0hypothetical protein EUTSA_v10004701mg
SwissprotQ9FUD31e-169BZIP9_ARATH; Basic leucine zipper 9
TrEMBLV4KQ170.0V4KQ17_EUTSA; Uncharacterized protein
STRINGBra020471.1-P1e-172(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63702641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-142basic leucine zipper 9