PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004611m
Common NameEUTSA_v10004611mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 320aa    MW: 34841 Da    PI: 8.7082
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004611mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.21.1e-15159211456
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                      +kr rr+ +NRe+ArrsR+RK+a + eLe+ v +L  eN++L k l e +++ 
  Thhalv10004611m 159 VKRVRRMLSNRESARRSRRRKQAHLSELETQVSQLRVENSKLMKGLTEVTQTF 211
                      79*****************************************9999888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-17156220IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.9E-12158211No hitNo description
PROSITE profilePS5021711.139158209IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.26E-12159210No hitNo description
PfamPF001701.5E-13159209IPR004827Basic-leucine zipper domain
PROSITE patternPS000360163178IPR004827Basic-leucine zipper domain
PfamPF124985.8E-14227275IPR020983Basic leucine-zipper, C-terminal
PfamPF124984.2E-6285314IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MEKVFSVEEF SGNLLWSELA KEADGTTAMN RSDSEWAFHR FIQESSAAGE ATTASGVSVS  60
GPPSPSVPVD SEEYREFLKN KLNLACAAVA MKRGSFIKPQ ETSGRSENGG AYTSSASEQA  120
SLASSKATPM MSSAITSGSE LSGDEEEADG ETNMNPSNVK RVRRMLSNRE SARRSRRRKQ  180
AHLSELETQV SQLRVENSKL MKGLTEVTQT FNDAAVENRV LKANIETLRA KVKMAEETVK  240
RITGFNPMFH TMPQVSTVSL PPETSNSLDE SIHVTTPPET SSGNKSKALI GCKMNRTASM  300
RRVASLEHLQ KRIRSVGDQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172179RRSRRRKQ
2174179SRRRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532650.0AK353265.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-34-D15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395031.10.0hypothetical protein EUTSA_v10004611mg
SwissprotB9DGI81e-177BZP63_ARATH; Basic leucine zipper 63
TrEMBLE4MXL80.0E4MXL8_EUTHA; mRNA, clone: RTFL01-34-D15
TrEMBLV4KQP70.0V4KQP7_EUTSA; Uncharacterized protein
STRINGBra020620.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68462743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-152bZIP family protein