PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004583m
Common NameEUTSA_v10004583mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 328aa    MW: 36805.9 Da    PI: 7.622
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004583mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.91.3e-55201461129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lp+GfrFhPtdeel+++yL++kv ++ +++  +i evd++kvePwdLp k+k +e++wyfF+ rd+ky+tg r+nratk+gyWkatgkdke+++
  Thhalv10004583m  20 LPAGFRFHPTDEELISHYLRPKVLNTFFSA-IAIGEVDLNKVEPWDLPWKAKIGENQWYFFCVRDRKYPTGLRTNRATKAGYWKATGKDKEIFN 112
                      799************************999.88***************98999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +++lvg+kktLvfykgrapkg+kt+Wvmheyrle
  Thhalv10004583m 113 -GKSLVGMKKTLVFYKGRAPKGVKTNWVMHEYRLE 146
                      .999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-6217170IPR003441NAC domain
PROSITE profilePS5100557.58620170IPR003441NAC domain
PfamPF023651.4E-2921145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0042542Biological Processresponse to hydrogen peroxide
GO:0051091Biological Processpositive regulation of sequence-specific DNA binding transcription factor activity
GO:1900057Biological Processpositive regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDYELSRIGE IVEDSKQIDL PAGFRFHPTD EELISHYLRP KVLNTFFSAI AIGEVDLNKV  60
EPWDLPWKAK IGENQWYFFC VRDRKYPTGL RTNRATKAGY WKATGKDKEI FNGKSLVGMK  120
KTLVFYKGRA PKGVKTNWVM HEYRLEGKYA VDNLPKNAKN DWVISRVFQK RADGKKMHIS  180
GLRMLGSGIN QSKPVGLPPL MDYSPYLQNG GGDSFAGSLS HVTCFSDQTT EDKSLLSEPK  240
DEINLTMFGS SLAPLIPNIG SMLYSDPVFL KDNSSILKML LDSEEIHFKE NLQGLGTSEN  300
ELTASSWQGH DPSGSAGPVM VDCFWNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-511717614171NO APICAL MERISTEM PROTEIN
1ut4_B2e-511717614171NO APICAL MERISTEM PROTEIN
1ut7_A2e-511717614171NO APICAL MERISTEM PROTEIN
1ut7_B2e-511717614171NO APICAL MERISTEM PROTEIN
4dul_A2e-511717614171NAC domain-containing protein 19
4dul_B2e-511717614171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382720.0KF738272.1 Brassica napus NAC transcription factor 59 (NAC59.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395312.10.0hypothetical protein EUTSA_v10004583mg
SwissprotQ9LJW31e-172NAC59_ARATH; NAC domain-containing protein 59
TrEMBLV4KYS70.0V4KYS7_EUTSA; Uncharacterized protein
STRINGBra036223.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29035.11e-174NAC domain containing protein 3