PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004436m
Common NameEUTSA_v10004438mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 369aa    MW: 41935.6 Da    PI: 7.7907
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004436mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-1182118339
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                      ++k +rr+++NReAAr+sR+RKka++++Le+   +L 
  Thhalv10004436m  82 PDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLI 118
                      6899**************************8655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-580138IPR004827Basic-leucine zipper domain
PfamPF001702.1E-882113IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.77282124IPR004827Basic-leucine zipper domain
CDDcd147084.52E-2284135No hitNo description
SuperFamilySSF579592.56E-784119No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-786112No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
PfamPF141442.8E-31170245IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MNSTSTHFVP PRRVGIYEPL HQIGMWGETF KSNIGNGNMN TPSHIIIPNH QKLDNNLSED  60
TSHGTAGTPH MFDQEASTSR HPDKIQRRLA QNREAARKSR LRKKAYVQQL ETSRLKLIQL  120
EQELDRARQQ GFYVGNGIDT NPLGFSETMN PGIAAFEMEY GHWVEEQNRQ ICELRTALHG  180
HVSDAELRLL VETAMKHYFE LFRMKSAAAK SDVFFVMSGM WKTSAERFFL WIGGFRPSDL  240
LKVLLPHFDI LTDQQILDVC NLRQSCQQAE DALSQGMEKL QHTLADCVAA GQLGEGSYIP  300
QVNSAMERLE ALVSFVNQAD HLRHETLLQM HRILTTRQAA RGLLALGEYF QRLRALSSSW  360
ATRHREPT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00586DAPTransfer from AT5G65210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1288380.0AY128838.1 Arabidopsis thaliana DNA binding protein TGA1a-like protein (At5g65210) mRNA, complete cds.
GenBankAY0995930.0AY099593.1 Arabidopsis thaliana DNA binding protein TGA1a-like protein (At5g65210) mRNA, complete cds.
GenBankAY0870490.0AY087049.1 Arabidopsis thaliana clone 31032 mRNA, complete sequence.
GenBankAK3174880.0AK317488.1 Arabidopsis thaliana AT5G65210 mRNA, complete cds, clone: RAFL23-11-L19.
GenBankAK3171420.0AK317142.1 Arabidopsis thaliana AT5G65210 mRNA, complete cds, clone: RAFL21-72-M22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394063.10.0hypothetical protein EUTSA_v10004438mg
RefseqXP_006394064.10.0hypothetical protein EUTSA_v10004438mg
RefseqXP_006394065.10.0hypothetical protein EUTSA_v10004438mg
SwissprotQ392370.0TGA1_ARATH; Transcription factor TGA1
TrEMBLV4MIZ50.0V4MIZ5_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0008_30700.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.50.0bZIP family protein