PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10003395m
Common NameEUTSA_v10003395mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family GeBP
Protein Properties Length: 177aa    MW: 21110.3 Da    PI: 6.5152
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10003395mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57342.91.3e-131258248
           DUF573  2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfk 48
                     +f+rlw+e+Dei++Lq +idfk ++gks+s+d d++y f k+ i+++
  Thhalv10003395m 12 YFERLWTENDEITFLQRVIDFKVDQGKSYSEDKDGLYVFTKELIEIN 58
                     79****************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.6E-81359IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MKGLQVFPRI SYFERLWTEN DEITFLQRVI DFKVDQGKSY SEDKDGLYVF TKELIEINKI  60
KYIDKDLSFM KPHDLWIVLH CQNNFGPECL CSVIHNCKKK VQDDKNDGLI HGEDLEPQKT  120
CDWFDKSFIF PSMVFYGVDE DTRKLRWRSA LVESKKKNEE KMKVLRANEI VYILEKI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403233.11e-129hypothetical protein EUTSA_v10003395mg, partial
TrEMBLV4NF211e-129V4NF21_EUTSA; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-19DNA-binding storekeeper protein-related transcriptional regulator