PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10003246m
Common NameEUTSA_v10003246mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 324aa    MW: 35370.4 Da    PI: 5.2219
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10003246mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.23.1e-17239298261
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                      ++ +r+rr++kNRe+A rsR+RK+a++ eLe  +++Le+eN++L ke+ee +ke +k  +
  Thhalv10003246m 239 AAAQRQRRMIKNRESAARSRERKQAYQVELESLAAKLEEENETLSKEIEEKRKERYKKLM 298
                      5789*************************************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.1E-13236293No hitNo description
SMARTSM003387.8E-13238302IPR004827Basic-leucine zipper domain
PfamPF001702.3E-16239299IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.519240292IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.88E-10242294No hitNo description
CDDcd147076.07E-19242288No hitNo description
PROSITE patternPS000360245260IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MASFKVLHSS NSRNSDLSRR IPSSSSSSIR PQQFRRDPIA DESRISGGYG GSNDGYGSNT  60
MTVEGILHDA FASDPPATDS SLLEASITLM DTPSAPMEIT TVSDLDRGGG GGTETRGKSV  120
DEVWRDIVSG EGKGMKEETQ EEIMTLEDFL AKAAGGDSAT VVGNGGGESD DMDVKIPPER  180
LDYGFDHSAP PHNPFQMIDK VEGSIVAFGN GLDVYGGGRG GGGARGKRAR VMVEPLDKAA  240
AQRQRRMIKN RESAARSRER KQAYQVELES LAAKLEEENE TLSKEIEEKR KERYKKLMEF  300
VIPVAEKPQQ QPRFLRRIRS LEW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1216222GGRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534790.0AK353479.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-45-A18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403144.10.0hypothetical protein EUTSA_v10003246mg
SwissprotP427773e-81GBF4_ARATH; G-box-binding factor 4
TrEMBLE4MY820.0E4MY82_EUTHA; mRNA, clone: RTFL01-45-A18
TrEMBLV4LQ580.0V4LQ58_EUTSA; Uncharacterized protein
STRINGAT5G44080.11e-152(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-104bZIP family protein