PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10002027m
Common NameEUTSA_v10002027mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 357aa    MW: 40573.6 Da    PI: 5.5216
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10002027mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.78.2e-48141401128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                      l pGf+F+Ptd el+++yL++k++g++ ++  vi+e++iyk+ePwdLp ++  ++e+ew++F+ r +ky++g++++rat+ gyWkatgk+++v+
  Thhalv10002027m  14 LFPGFKFSPTDVELISYYLRRKIDGDEDSV-AVIAEAEIYKFEPWDLPeESKLKSENEWFYFCARGRKYPHGSQSRRATQLGYWKATGKERSVK 106
                      579************************998.89***************433334678************************************* PP

              NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      s +++ vg+k+tLvf+ grap+ge+t+W+mhey +
  Thhalv10002027m 107 S-GNQIVGTKRTLVFHIGRAPRGERTEWIMHEYCI 140
                      *.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-536155IPR003441NAC domain
PROSITE profilePS5100551.84314156IPR003441NAC domain
PfamPF023657.1E-2416139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MSKEAEMSIA VSALFPGFKF SPTDVELISY YLRRKIDGDE DSVAVIAEAE IYKFEPWDLP  60
EESKLKSENE WFYFCARGRK YPHGSQSRRA TQLGYWKATG KERSVKSGNQ IVGTKRTLVF  120
HIGRAPRGER TEWIMHEYCI HNAPQDALVV CRLRKNTDFR ACSNQRPMDN GHVQTDEYVD  180
QTSGLETEEK SFSVYEPELQ ISNGDIAESS NAVEDRANTD DDCYAEILND DIIKLDEEAD  240
CSIRKESKQT MNCNYALFRM KNVATGTAST DWRIPNPFHM KKDDSQRLIK NILATTAFLT  300
ILISVFFTML TTRDYTSYKA MYSASVVDKA TTGCKSDFQL STFPPAVKTY PVNNLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-41415310165Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006408703.10.0hypothetical protein EUTSA_v10002027mg
SwissprotQ9XIN70.0NAC40_ARATH; NAC domain-containing protein 40
TrEMBLV4NTW00.0V4NTW0_EUTSA; Uncharacterized protein
STRINGAT2G27300.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM104532533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.10.0NTM1-like 8